KEGG   Paenibacillus polymyxa M1: PPM_0981Help
Entry
PPM_0981          CDS       T01968                                 

Gene name
melA7
Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ppo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PPM_0981 (melA7)
  Lipid metabolism
   00561 Glycerolipid metabolism
    PPM_0981 (melA7)
   00600 Sphingolipid metabolism
    PPM_0981 (melA7)
Enzymes [BR:ppo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     PPM_0981 (melA7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1209645..1211159
Genome map
AA seq 504 aa AA seqDB search
MSFKVAFIGAGSIGFTRGILRDLLSVPEFNNIEVAFTDISQHNLDMVTELCQRDIRENGL
SIQIQSSTDRKVALKDAKYVICTIRVGGLEAFATDVDIPLKYGVDQCVGDTLCAGGIMYG
QRGIAEMLEICKDIRELSAPDVLLLNYSNPMAMMTWACNKYGGVRTVGLCHGVQNGHHQI
AEAYGLEKQDVDIVCAGINHQTWYIQASHKGKDLTAGLLEAFEQHPEFSRTEKVRIDMLR
RFGYYSTESNGHLSEYVPWYRKRPNEILDWIDLGNWINGETGGYLRVCTEGRNWFETDFP
NWMKEEPLEYKAESRGEEHGSYIIEGLETGRVYRGHFNVINHGVISNLPDDAIIEAPGYV
DRNGISMPHVGELPLGPAAVCNVSISVQRLAVEAAVHGDDKLLRQAFMMDPLVGAVCNPK
EIWQMVDEMLVAQEAWLPQYGAAIAEARQRLAAGDLIPTRPYEGAARLKVKTVEEMQLDR
DAANKNAGQSDKGKDREKVQNSKA
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
gtgtcatttaaagtagcttttattggagcaggaagcatcggttttacccgtggaattttg
cgggatctgttatcggtaccggagtttaacaatattgaagtggcttttacggacatcagt
cagcacaatctggatatggttactgaactgtgtcaacgggatattcgtgagaatggtttg
tccatacaaatacagtcctctacggatcgaaaggtagctctaaaggatgccaaatacgtc
atttgtacaatccgtgtcggcggtctcgaagcttttgcgaccgatgtggatattccgcta
aaatacggtgtggatcaatgcgtgggcgatacattatgtgcaggaggcatcatgtatggt
cagcgtggtatcgctgaaatgctggagatttgcaaagatatccgcgagttaagtgcaccg
gatgtactgctgttgaactactcgaaccccatggcaatgatgacctgggcgtgcaacaag
tacggcggcgtgcgtacggttggtctatgtcatggcgttcagaatgggcatcaccaaatt
gccgaggcgtacggtctggagaagcaggatgtggacattgtatgcgccggaatcaatcac
caaacatggtatattcaggcctcacataagggcaaggatctgacagccggactgctggag
gcatttgaacaacatcctgaatttagccgcaccgaaaaggtacgcatcgatatgcttcgt
cgttttggctattacagcacagagtcgaatggtcatctcagtgaatatgtgccttggtat
cggaagcgtccgaatgaaattctggactggattgacctgggcaactggatcaacggagaa
acaggcggctatctgcgtgtatgtacggaaggacgcaactggtttgaaacagatttcccc
aactggatgaaggaagagccactggagtacaaggcagagagtcgcggtgaagagcacggc
tcatacattatcgaaggtctggaaacaggacgtgtataccggggacattttaatgttatt
aatcatggggtaatttccaacctgccggacgatgcgattattgaagcccctggatatgtg
gatcggaatggcatttccatgccgcatgttggagaactgccgctcggtcctgctgccgtg
tgcaatgttagtatttccgttcagcgtttggctgtcgaagcggctgtacatggagacgat
aagctgctgcgccaagcgtttatgatggacccgttagtgggcgcggtgtgtaatccaaaa
gaaatttggcagatggtcgatgagatgctggtggcacaggaggcatggttgccgcaatat
ggagcagcgattgccgaggcgcgccaacgtttggctgcaggcgatctgattccgacccga
ccttatgagggagcagcgcggcttaaggtgaagacggttgaagaaatgcagctggaccgg
gatgctgccaataaaaatgcaggacaatccgacaaaggcaaggatcgcgaaaaagtgcag
aacagcaaggcgtaa

DBGET integrated database retrieval system