KEGG   Paenibacillus polymyxa M1: PPM_1093Help
Entry
PPM_1093          CDS       T01968                                 

Gene name
gtaB1
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ppo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PPM_1093 (gtaB1)
   00052 Galactose metabolism
    PPM_1093 (gtaB1)
   00500 Starch and sucrose metabolism
    PPM_1093 (gtaB1)
   00520 Amino sugar and nucleotide sugar metabolism
    PPM_1093 (gtaB1)
Enzymes [BR:ppo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PPM_1093 (gtaB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1341747..1342640
Genome map
AA seq 297 aa AA seqDB search
MMKKVKKAIIPAAGLGTRFLPATKAMPKEMLPIINKPTIQYIVEEAIASGIEDIIIVTGK
GKRAIEDHFDNAFELESKLLEDGKLKLLEEVQRSSGVEIHYIRQKEPKGLGHAVWCARRF
IGDEPFGVLLGDDIVTGQKPCLRQLMDQYEETQNSVIGVQRVPQEFTNRYGIIEPDQQDG
RLYRVNNFIEKPAPGTAPSDLAIMGRYVFSPKIFKYLDLQEKGAGGEIQLTDAIQKLNQS
ERVYAYDFEGTRYDVGERLGYILTTLEFALASDDLKYPVMEAMNEWLKKTEKATTVG
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaaaagtgaaaaaggccattattccagcagcaggattgggaacgcgcttcctc
cctgctaccaaagcaatgcctaaggaaatgcttccgattatcaataagcctacgattcaa
tatatcgtggaagaagcgattgcttctggtatcgaggacattattatcgttacgggtaaa
ggtaaacgtgccattgaggaccactttgacaacgcatttgagttggaatcaaagctgctc
gaggacggtaagctgaagcttctggaggaagtacagcgttcttcgggagtggaaatccat
tacattcgccagaaagaaccgaaaggtctgggacatgcggtgtggtgcgcaagacgcttt
atcggggacgagccatttggtgtgctgttgggcgacgatatcgtaacaggtcaaaaacct
tgtctgcgccagctgatggatcaatatgaggaaacacaaaattctgtgatcggcgtgcag
cgggtaccacaggaattcacgaaccggtatggcatcattgaaccggaccaacaggacgga
cgattgtaccgagtgaataattttattgaaaaaccggctccaggcacagccccatccgat
ctggctattatgggtcgttatgtgttctcaccgaaaattttcaaatatcttgatcttcag
gaaaaaggagctggcggcgaaattcagttgacggatgcgatccaaaagctgaatcagagt
gaacgcgtatacgcctatgactttgaaggcacgcgttatgacgtaggtgaacgtcttgga
tatattttaaccactcttgaatttgcacttgccagcgatgatttgaagtatccggttatg
gaggccatgaatgaatggctgaaaaagaccgagaaagcaaccacagtgggttga

DBGET integrated database retrieval system