KEGG   Paenibacillus polymyxa M1: PPM_1093Help
Entry
PPM_1093          CDS       T01968                                 

Gene name
gtaB1
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
ppo00040  Pentose and glucuronate interconversions
ppo00052  Galactose metabolism
ppo00500  Starch and sucrose metabolism
ppo00520  Amino sugar and nucleotide sugar metabolism
ppo01100  Metabolic pathways
ppo01130  Biosynthesis of antibiotics
Module
ppo_M00362  Nucleotide sugar biosynthesis, prokaryotes
ppo_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ppo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PPM_1093 (gtaB1)
   00052 Galactose metabolism
    PPM_1093 (gtaB1)
   00500 Starch and sucrose metabolism
    PPM_1093 (gtaB1)
   00520 Amino sugar and nucleotide sugar metabolism
    PPM_1093 (gtaB1)
Enzymes [BR:ppo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PPM_1093 (gtaB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD Glycos_transf_2 CTP_transf_3 Smr
Motif
Other DBs
NCBI-ProteinID: CCC84030
Position
1341747..1342640
Genome map
AA seq 297 aa AA seqDB search
MMKKVKKAIIPAAGLGTRFLPATKAMPKEMLPIINKPTIQYIVEEAIASGIEDIIIVTGK
GKRAIEDHFDNAFELESKLLEDGKLKLLEEVQRSSGVEIHYIRQKEPKGLGHAVWCARRF
IGDEPFGVLLGDDIVTGQKPCLRQLMDQYEETQNSVIGVQRVPQEFTNRYGIIEPDQQDG
RLYRVNNFIEKPAPGTAPSDLAIMGRYVFSPKIFKYLDLQEKGAGGEIQLTDAIQKLNQS
ERVYAYDFEGTRYDVGERLGYILTTLEFALASDDLKYPVMEAMNEWLKKTEKATTVG
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaaaagtgaaaaaggccattattccagcagcaggattgggaacgcgcttcctc
cctgctaccaaagcaatgcctaaggaaatgcttccgattatcaataagcctacgattcaa
tatatcgtggaagaagcgattgcttctggtatcgaggacattattatcgttacgggtaaa
ggtaaacgtgccattgaggaccactttgacaacgcatttgagttggaatcaaagctgctc
gaggacggtaagctgaagcttctggaggaagtacagcgttcttcgggagtggaaatccat
tacattcgccagaaagaaccgaaaggtctgggacatgcggtgtggtgcgcaagacgcttt
atcggggacgagccatttggtgtgctgttgggcgacgatatcgtaacaggtcaaaaacct
tgtctgcgccagctgatggatcaatatgaggaaacacaaaattctgtgatcggcgtgcag
cgggtaccacaggaattcacgaaccggtatggcatcattgaaccggaccaacaggacgga
cgattgtaccgagtgaataattttattgaaaaaccggctccaggcacagccccatccgat
ctggctattatgggtcgttatgtgttctcaccgaaaattttcaaatatcttgatcttcag
gaaaaaggagctggcggcgaaattcagttgacggatgcgatccaaaagctgaatcagagt
gaacgcgtatacgcctatgactttgaaggcacgcgttatgacgtaggtgaacgtcttgga
tatattttaaccactcttgaatttgcacttgccagcgatgatttgaagtatccggttatg
gaggccatgaatgaatggctgaaaaagaccgagaaagcaaccacagtgggttga

DBGET integrated database retrieval system