KEGG   Paenibacillus polymyxa M1: PPM_1208Help
Entry
PPM_1208          CDS       T01968                                 

Gene name
bsaA1
Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ppo00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PPM_1208 (bsaA1)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PPM_1208 (bsaA1)
Enzymes [BR:ppo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PPM_1208 (bsaA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1467736..1468221)
Genome map
AA seq 161 aa AA seqDB search
MSVYKYDAQTLQGAQIPLSTYEGKVLLIVNTASKCGLTPQYKALQELYDQYHEQGLEILG
FPSNQFAKQEPGSSEEISEFCQINYGVTFPMFAKTDVNGDQAHPLFRYLTHTAPGVLGSK
AIKWNFTKFLITREGNVFKRYAPQTTPDKLIGDIEKLLRKN
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtatataaatatgatgcacagaccctacaaggggcacaaattccattatccacc
tacgaagggaaagttcttcttatcgtgaatactgccagcaaatgtgggttaaccccccag
tacaaggcgctacaagagctatatgaccagtatcatgaacaggggctcgaaattttggga
tttcccagcaaccagttcgccaaacaagagccgggctccagcgaggagatctctgagttt
tgccaaatcaattacggtgtgaccttccccatgttcgccaagacagatgtcaacggtgat
caggcacatcctctatttcgctacctgacccacactgctccgggagtattaggctccaaa
gcgatcaaatggaatttcactaaattcttaattacacgagaaggtaacgtatttaagcgt
tatgcgccgcaaaccactccagataagcttataggagatatagagaagcttttgcggaaa
aactga

DBGET integrated database retrieval system