KEGG   Paenibacillus polymyxa M1: PPM_1284Help
Entry
PPM_1284          CDS       T01968                                 

Gene name
phoB1
Definition
(GenBank) alkaline phosphatase III precursor
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
ppo00730  Thiamine metabolism
ppo00790  Folate biosynthesis
ppo01100  Metabolic pathways
ppo02020  Two-component system
Module
ppo_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ppo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    PPM_1284 (phoB1)
   00790 Folate biosynthesis
    PPM_1284 (phoB1)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PPM_1284 (phoB1)
Enzymes [BR:ppo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PPM_1284 (phoB1)
Exosome [BR:ppo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PPM_1284 (phoB1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ppo00537]
 Enzymes
  PPM_1284 (phoB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-ProteinID: CCC84221
Position
1551972..1553267
Genome map
AA seq 431 aa AA seqDB search
MKKSILALSAVTVLTVPLLSADIPTAFAAATSTKSTVAESKAQKAVSAKADTPKNVILFI
GDGMGEASRNAIRLATVGKSGLLEMDKMPITGLVSTSSGDNLVTDSAAAATAIATGVKTY
NGAIGMDLNKKPVTTIMELAKKAGMSTGVVTTSQVTDATGAAFGAHVEKRSAQSEIAKQY
LEKSKLDVILGGGEDFWYPAGTPGKHPDAPAEDPEEASKGTQGNLVEQAKKLGYSYVTDQ
AEMKAAKGSKLLGLFANEEMFQAHNKLGNSYNPTVSLPDMTAKAIDVLSKNKKGFFLMVE
EEGTDEMAHDNEGELTIKAGQQLDKAVKVAKDYAKAHPDTLVLVTADHETGGLAIEGEDA
EDESGEGVSKEDGPFTVKGSDEKFYIDWTTGGHTSVDVALTAMGPGSSQFSGNYPNTAIH
DKLVKLLQLKK
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagagtatccttgcgttaagtgctgtgactgttttgactgtacccttattatct
gctgatatccctacagcttttgcagccgcgacttctacgaagtccactgttgcagagtcc
aaggcacagaaggctgtatcagctaaagcggatactcctaaaaacgtcattctttttatc
ggtgatggtatgggggaagccagtcgcaacgcgattcgcttagcaacggttggaaaatcg
ggattgcttgaaatggacaagatgcctataacgggtctggttagcacgagttcaggggac
aacctagttacagactctgccgctgctgcgactgccattgcaacaggtgtgaaaacgtat
aacggcgcgatcggaatggatttgaataaaaaaccagtgacaaccattatggagctggct
aaaaaagcaggcatgtctacaggagtggtgacgacaagccaagtgacagatgcgacgggc
gctgcctttggtgcgcatgttgagaagcgctccgcgcaaagcgagattgccaagcagtat
cttgagaaaagcaagctggatgtgattctgggcgggggtgaggatttctggtaccctgca
ggaacaccaggcaaacatccagatgcaccggcagaagatcctgaggaagctagtaaggga
actcaaggaaatttggtggaacaagcgaagaagttgggctatagctatgtgacagatcag
gctgaaatgaaagcagccaaaggctctaaactgctaggtctattcgccaatgaagaaatg
ttccaagctcacaacaaactaggcaattcttacaacccaacggtttctttaccggatatg
acagcgaaagcgattgatgttctatccaaaaacaaaaaaggctttttcctgatggtagag
gaagaaggaactgatgagatggcgcatgacaatgaaggtgaattaaccattaaagccggg
cagcagctggataaggctgtcaaagtagctaaggactatgccaaagcgcatccagatact
ttggtgttagtgacggcagaccatgaaacaggcggtttggccattgaaggcgaagatgcg
gaagatgaatccggtgaaggtgtctccaaagaggacggcccttttaccgtaaaaggttct
gatgagaagttttatatcgactggaccacaggaggacatacatccgttgatgtagcgcta
actgcaatgggtccgggttcctcccaatttagtggaaattacccgaatacggctattcat
gacaagctggttaagctgcttcaattaaaaaaatag

DBGET integrated database retrieval system