KEGG   Paenibacillus polymyxa M1: PPM_1284Help
Entry
PPM_1284          CDS       T01968                                 

Gene name
phoB1
Definition
alkaline phosphatase III precursor (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ppo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PPM_1284 (phoB1)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    PPM_1284 (phoB1)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PPM_1284 (phoB1)
Enzymes [BR:ppo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PPM_1284 (phoB1)
Exosome [BR:ppo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PPM_1284 (phoB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1551972..1553267
Genome map
AA seq 431 aa AA seqDB search
MKKSILALSAVTVLTVPLLSADIPTAFAAATSTKSTVAESKAQKAVSAKADTPKNVILFI
GDGMGEASRNAIRLATVGKSGLLEMDKMPITGLVSTSSGDNLVTDSAAAATAIATGVKTY
NGAIGMDLNKKPVTTIMELAKKAGMSTGVVTTSQVTDATGAAFGAHVEKRSAQSEIAKQY
LEKSKLDVILGGGEDFWYPAGTPGKHPDAPAEDPEEASKGTQGNLVEQAKKLGYSYVTDQ
AEMKAAKGSKLLGLFANEEMFQAHNKLGNSYNPTVSLPDMTAKAIDVLSKNKKGFFLMVE
EEGTDEMAHDNEGELTIKAGQQLDKAVKVAKDYAKAHPDTLVLVTADHETGGLAIEGEDA
EDESGEGVSKEDGPFTVKGSDEKFYIDWTTGGHTSVDVALTAMGPGSSQFSGNYPNTAIH
DKLVKLLQLKK
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagagtatccttgcgttaagtgctgtgactgttttgactgtacccttattatct
gctgatatccctacagcttttgcagccgcgacttctacgaagtccactgttgcagagtcc
aaggcacagaaggctgtatcagctaaagcggatactcctaaaaacgtcattctttttatc
ggtgatggtatgggggaagccagtcgcaacgcgattcgcttagcaacggttggaaaatcg
ggattgcttgaaatggacaagatgcctataacgggtctggttagcacgagttcaggggac
aacctagttacagactctgccgctgctgcgactgccattgcaacaggtgtgaaaacgtat
aacggcgcgatcggaatggatttgaataaaaaaccagtgacaaccattatggagctggct
aaaaaagcaggcatgtctacaggagtggtgacgacaagccaagtgacagatgcgacgggc
gctgcctttggtgcgcatgttgagaagcgctccgcgcaaagcgagattgccaagcagtat
cttgagaaaagcaagctggatgtgattctgggcgggggtgaggatttctggtaccctgca
ggaacaccaggcaaacatccagatgcaccggcagaagatcctgaggaagctagtaaggga
actcaaggaaatttggtggaacaagcgaagaagttgggctatagctatgtgacagatcag
gctgaaatgaaagcagccaaaggctctaaactgctaggtctattcgccaatgaagaaatg
ttccaagctcacaacaaactaggcaattcttacaacccaacggtttctttaccggatatg
acagcgaaagcgattgatgttctatccaaaaacaaaaaaggctttttcctgatggtagag
gaagaaggaactgatgagatggcgcatgacaatgaaggtgaattaaccattaaagccggg
cagcagctggataaggctgtcaaagtagctaaggactatgccaaagcgcatccagatact
ttggtgttagtgacggcagaccatgaaacaggcggtttggccattgaaggcgaagatgcg
gaagatgaatccggtgaaggtgtctccaaagaggacggcccttttaccgtaaaaggttct
gatgagaagttttatatcgactggaccacaggaggacatacatccgttgatgtagcgcta
actgcaatgggtccgggttcctcccaatttagtggaaattacccgaatacggctattcat
gacaagctggttaagctgcttcaattaaaaaaatag

DBGET integrated database retrieval system