KEGG   Paenibacillus polymyxa M1: PPM_1322Help
Entry
PPM_1322          CDS       T01968                                 

Gene name
odhB
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component,dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
ppo00020  Citrate cycle (TCA cycle)
ppo00310  Lysine degradation
ppo01100  Metabolic pathways
ppo01110  Biosynthesis of secondary metabolites
ppo01120  Microbial metabolism in diverse environments
ppo01130  Biosynthesis of antibiotics
ppo01200  Carbon metabolism
Module
ppo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PPM_1322 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    PPM_1322 (odhB)
Enzymes [BR:ppo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PPM_1322 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 RnfC_N
Motif
Other DBs
NCBI-ProteinID: CCC84259
Position
1587580..1588875
Genome map
AA seq 431 aa AA seqDB search
MSDIIVPAMGESITEGTISKWLVKEGDSVGQGDVLLELETDKVNLEISAEEAGVVQKILR
QEGDTVVIGEAVGLIGNDSGAEATGAGEAAATQAPEAPSVATSQTSVESGGKAVEKSAPP
IPSNSDGNGQTASPSARKLARERGIDLEQVQGKDPLGRVFQEDVKTHNSAEVSRTASVPA
SPAAGKSVSPSPAQTEYSKPVERQRMSRRRATIAKRLVEAQQTAAMLTTFNEVDMTAILD
VRKRRKDKFKEKHDVGLGFMSFFTKAVVGALKRFPTVNAEINGDDIVLKKYYDIGIAVSA
KEGLVVPVVRDADRLGFAEIEKSIADLASKARSNSLSLGDLQGGTFTITNGGIFGSLLST
PILNTPQVGILGMHKIQLRPIAIDEERMENRPMMYIALSYDHRIIDGSEAVRFLVTVKEL
LEDPESLLLEG
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgatattatagtgccagcaatgggagaatccatcacggaaggaacaatctccaaa
tggcttgtaaaggaaggagattccgtaggacagggagatgttctactggagctggaaacg
gataaggtcaatctggaaattagcgccgaagaagcaggtgtagtccagaaaatccttcgt
caagagggggatactgtggttatcggtgaagctgttggcttgatcggaaacgacagtggt
gcggaagcaactggtgccggagaagccgcagcgactcaagcgcctgaagcgccgtccgta
gcaacttcacagacttccgtagaaagcggcggtaaagcagtagaaaagtctgcgccgccc
atcccctccaatagtgacgggaatggtcagacggcatcaccatccgcccggaagctggcg
cgtgagcgcgggattgaccttgagcaggtacaaggaaaggacccgcttggacgtgtgttt
caggaggacgtaaaaacgcataacagcgctgaagtatcacgtacagcatctgtacctgcg
tctcccgctgctggcaagtctgtgtcaccgtctccagctcaaacagagtacagcaagcct
gtggaacggcagcggatgtcccgtcggagagcgacgattgccaagcgtcttgttgaagca
cagcaaacagccgccatgcttacgacttttaatgaagtggatatgaccgctattcttgat
gtgcgcaaacgccgtaaagataagtttaaggagaaacatgatgtagggctgggttttatg
tccttctttacgaaggcagtggttggcgcgctcaagcgcttccctactgtgaatgcagaa
atcaatggcgatgatatcgtactgaaaaaatactatgatatcgggattgctgtatctgcc
aaggaaggtttggtcgttcctgttgttagggatgctgatcggcttggttttgctgaaatt
gagaagagcattgccgatttggctagcaaagctcgttccaattcactttctctgggagac
ttgcaaggaggaacctttaccataaccaatggaggtattttcggttccctgctgtctacg
ccaattctgaatacgccgcaagtgggtattttgggaatgcataaaatccaacttcgcccg
attgccatcgacgaggaacgtatggaaaatcgtccgatgatgtatatcgcgttgtcctat
gaccaccgtattattgatggtagcgaggcggtccgtttcctggtaacggtcaaagaattg
ctggaagatcccgaatcattgttgctggaaggataa

DBGET integrated database retrieval system