KEGG   Paenibacillus polymyxa M1: PPM_1322Help
Entry
PPM_1322          CDS       T01968                                 

Gene name
odhB
Definition
2-oxoglutarate dehydrogenase, E2 component,dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PPM_1322 (odhB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PPM_1322 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    PPM_1322 (odhB)
Enzymes [BR:ppo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PPM_1322 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1587580..1588875
Genome map
AA seq 431 aa AA seqDB search
MSDIIVPAMGESITEGTISKWLVKEGDSVGQGDVLLELETDKVNLEISAEEAGVVQKILR
QEGDTVVIGEAVGLIGNDSGAEATGAGEAAATQAPEAPSVATSQTSVESGGKAVEKSAPP
IPSNSDGNGQTASPSARKLARERGIDLEQVQGKDPLGRVFQEDVKTHNSAEVSRTASVPA
SPAAGKSVSPSPAQTEYSKPVERQRMSRRRATIAKRLVEAQQTAAMLTTFNEVDMTAILD
VRKRRKDKFKEKHDVGLGFMSFFTKAVVGALKRFPTVNAEINGDDIVLKKYYDIGIAVSA
KEGLVVPVVRDADRLGFAEIEKSIADLASKARSNSLSLGDLQGGTFTITNGGIFGSLLST
PILNTPQVGILGMHKIQLRPIAIDEERMENRPMMYIALSYDHRIIDGSEAVRFLVTVKEL
LEDPESLLLEG
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgatattatagtgccagcaatgggagaatccatcacggaaggaacaatctccaaa
tggcttgtaaaggaaggagattccgtaggacagggagatgttctactggagctggaaacg
gataaggtcaatctggaaattagcgccgaagaagcaggtgtagtccagaaaatccttcgt
caagagggggatactgtggttatcggtgaagctgttggcttgatcggaaacgacagtggt
gcggaagcaactggtgccggagaagccgcagcgactcaagcgcctgaagcgccgtccgta
gcaacttcacagacttccgtagaaagcggcggtaaagcagtagaaaagtctgcgccgccc
atcccctccaatagtgacgggaatggtcagacggcatcaccatccgcccggaagctggcg
cgtgagcgcgggattgaccttgagcaggtacaaggaaaggacccgcttggacgtgtgttt
caggaggacgtaaaaacgcataacagcgctgaagtatcacgtacagcatctgtacctgcg
tctcccgctgctggcaagtctgtgtcaccgtctccagctcaaacagagtacagcaagcct
gtggaacggcagcggatgtcccgtcggagagcgacgattgccaagcgtcttgttgaagca
cagcaaacagccgccatgcttacgacttttaatgaagtggatatgaccgctattcttgat
gtgcgcaaacgccgtaaagataagtttaaggagaaacatgatgtagggctgggttttatg
tccttctttacgaaggcagtggttggcgcgctcaagcgcttccctactgtgaatgcagaa
atcaatggcgatgatatcgtactgaaaaaatactatgatatcgggattgctgtatctgcc
aaggaaggtttggtcgttcctgttgttagggatgctgatcggcttggttttgctgaaatt
gagaagagcattgccgatttggctagcaaagctcgttccaattcactttctctgggagac
ttgcaaggaggaacctttaccataaccaatggaggtattttcggttccctgctgtctacg
ccaattctgaatacgccgcaagtgggtattttgggaatgcataaaatccaacttcgcccg
attgccatcgacgaggaacgtatggaaaatcgtccgatgatgtatatcgcgttgtcctat
gaccaccgtattattgatggtagcgaggcggtccgtttcctggtaacggtcaaagaattg
ctggaagatcccgaatcattgttgctggaaggataa

DBGET integrated database retrieval system