KEGG   Paenibacillus polymyxa M1: PPM_1611Help
Entry
PPM_1611          CDS       T01968                                 

Gene name
bglH1
Definition
beta glucosidase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:ppo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPM_1611 (bglH1)
Enzymes [BR:ppo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     PPM_1611 (bglH1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1898185..1899594
Genome map
AA seq 469 aa AA seqDB search
MKHNQLKAFPENFFWGGSTSAYQVEGAWDEDGKGPSVIDMANHVEGVTDFKVTSDHYHMF
KEDVALMAEMGFKAYRFSIAWTRIYPQGAGEVNPKGIAFYSSLIDELIKYGIEPIVTMYH
FDLPYALEQQGGWSKRETIDAFEQYAKTLFENFGDRVKYWLTINEQNMLILHPGSIGTLD
TSLENPQKVLYQQNHHMLVAQAKAMVLCHEMLPDAKIGPAPNIGVIYPASSKPEDTLAAD
NYAAIRNWLYLDMAVFGRYNHIAWSYLVEKGYEPVIEEGDMDILAKGNPDFIAFNYYTSQ
TVGESLDDGNDFSHTGDQHEIVGEPGAYRGSVNPNLQTTEFGWEIDPVGFRTTLRQIYSR
YRLPLIVTENGLGAFDKLEEGDVVNDPYRIDFFKKHIEQIQLAITDGVEVFGFCPWSAID
LVSTHQGSSKRYGFIYVDREEFDLKDLRRIRKQSFYWYQKLIATNGEIR
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaaacataatcaattgaaggcatttcctgaaaattttttctggggaggttcaacttcc
gcttatcaagtagagggtgcatgggacgaagatggaaaaggcccctctgtcattgacatg
gctaaccatgttgaaggggtgactgattttaaggtaaccagtgatcattaccatatgttc
aaagaggacgtagctctgatggctgaaatgggctttaaggcgtatcgcttctcgatcgct
tggacacgcatctatccacaaggcgcgggtgaagtcaatccgaagggaattgcattttac
agctcattgattgacgaattaattaaatatggtattgaaccgattgttaccatgtatcat
tttgatctgccctatgcgcttgaacaacaaggcggatggtccaaaagggaaacgattgat
gccttcgagcagtatgccaaaacgttgtttgaaaactttggggacagggtgaaatactgg
ctaaccattaatgagcagaacatgctgattctccatcccggttctattggtacattggat
actagcctggaaaatccgcaaaaggtactgtatcagcaaaatcatcatatgttagtcgcg
caggcgaaggcgatggtgttgtgtcacgagatgctgcctgacgcgaaaattggaccagca
ccgaatattggggtcatttatccagccagttccaagccggaagatacgctggcggctgat
aactatgcagccattcgcaactggctttacctggatatggctgtatttggtcgctacaac
cacattgcctggagctatttggtcgagaagggttatgagcctgttattgaagaaggggat
atggatatattagcgaaaggaaatccagattttatcgcctttaactattacacctcccaa
accgtaggggaaagtttggatgatggaaatgatttttcacatacaggcgatcagcacgaa
attgtgggtgaacctggagcatatcgaggttctgtgaaccccaacctgcaaacgacagag
tttggttgggagattgatccggttggttttagaaccacattacgccagatatattctcgc
taccgcctgcctttaatcgtgacagagaacggcttgggcgcttttgacaagctggaagaa
ggagatgtagtgaacgatccttatcgtattgacttcttcaagaaacatatcgagcagatt
caattggctattacagacggcgtagaagtgttcggtttctgtccgtggtcagcgattgat
ctggttagtacccatcagggctccagtaagcgttacggattcatctatgtggatcgtgag
gaatttgatctcaaagatctgcgccgcattcgtaaacaaagcttctactggtatcaaaag
ctgatcgctacaaacggtgaaattcgttaa

DBGET integrated database retrieval system