KEGG   Paenibacillus polymyxa M1: PPM_1688Help
Entry
PPM_1688          CDS       T01968                                 

Gene name
hemY1
Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ppo00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1959009..1960454
Genome map
AA seq 481 aa AA seqDB search
MEQKLRNIVIVGGGLTGLSTAFYTRKMYKEAGYTPRITLVEKASALGGKIETLHKDGFVI
EKGPDSFLARKTAMIDLAKELEMDHELVSTNPEAKKTYILHEGQLHPMPPGLVLGIPTEL
KPFLRSGLISLGGKMRAMMDFVIPPRREPGDEALGDFIERRLGKEVLENVTEPLLAGIYA
ANMKTLSLQATFPQFAEVEQQYGSLIHGMRTGRKPAETHTGTKKSAFLTFRQGLQSLVHA
LLNDLYDCDLRTGIAVTEFTKTTETKGSPYCVMLDNGETLEADDIFVTTPNFAAAPLLRD
HVNVSALEAVNYVSVANVVMAFDKTDIENIFDGSGFLVPRKEGRSVTACTWTSAKWLHTS
PDDKVLLRCYVGRAGAEETVDLPDNELIAVVRKDLKEMMGVTATPLFTEITRLRNSMPQY
PVGHPQAIANLREELRSAMPGVYVLGAGYDAIGLPDCIRQAKEWASKAVHTAQREAVKVQ
V
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggagcaaaagttacgtaatattgtaattgtaggtggaggcttgaccgggcttagcact
gctttttatacacgaaaaatgtacaaagaagctggctacacacctcgaattacgctggtg
gagaaagcttccgcgctaggcggaaaaattgaaacattgcataaagatggttttgtcata
gaaaaggggccagattcctttctggcccgtaaaacggctatgatagatctggcaaaagag
ttagagatggatcatgagctggtaagcacgaaccctgaagctaaaaagacatatattttg
catgaaggtcagcttcatccgatgcctcctgggcttgtgctgggcattccaacagagcta
aaaccatttttacgcagtggcttgatctctttaggtggaaaaatgcgggctatgatggat
tttgtcattccgcctcgacgtgaaccgggagatgaggcgctgggtgattttattgaacgc
cgactgggcaaagaagtgctagagaatgtaaccgagccactgctggcgggaatctatgct
gccaacatgaagacgctaagtttgcaggcaacttttccacagtttgcagaggtggagcag
caatacggaagccttattcacgggatgaggacaggtcgaaaaccagctgaaacacatacg
ggtacgaaaaaaagcgcctttttgaccttccgtcaaggcttgcaaagtttggtgcatgcg
ttgctgaatgatttgtacgactgtgatttacgcaccggaattgctgttacagaattcaca
aagacaacggaaactaaaggaagtccctattgcgttatgttggacaatggagagacgctg
gaggcagatgatatttttgtaacgactcccaattttgctgctgcgccgctattgcgagat
catgtaaatgtgtctgcactggaagctgttaattacgtctccgtagcgaacgtggtcatg
gcctttgataaaacagatattgagaacatctttgacggctccggttttctggttcctcgc
aaagaaggacgtagtgtcacagcttgtacttggacgtccgccaagtggctacataccagc
ccggatgataaggtgctgttgcgttgttatgtagggcgagcaggagctgaagaaacagta
gacttaccggataatgagctgattgcggtggtacgtaaggatttgaaagagatgatggga
gttacagcaactccgctgttcacggaaattacacgtcttcgtaattccatgccgcaatac
ccggtagggcacccacaagctatagctaatctgcgggaagagctacgcagtgcgatgcca
ggggtgtacgttttaggcgctggctatgatgcaatcggtttgccggactgcatccgtcag
gctaaggaatgggcctccaaggctgtccacacagcacaacgggaagccgtcaaggtccag
gtataa

DBGET integrated database retrieval system