KEGG   Paenibacillus polymyxa M1: PPM_1703Help
Entry
PPM_1703          CDS       T01968                                 

Gene name
pfk
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:ppo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PPM_1703 (pfk)
   01230 Biosynthesis of amino acids
    PPM_1703 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPM_1703 (pfk)
   00030 Pentose phosphate pathway
    PPM_1703 (pfk)
   00051 Fructose and mannose metabolism
    PPM_1703 (pfk)
   00052 Galactose metabolism
    PPM_1703 (pfk)
  Energy metabolism
   00680 Methane metabolism
    PPM_1703 (pfk)
Enzymes [BR:ppo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PPM_1703 (pfk)
Protein phosphatases and associated proteins [BR:ppo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PPM_1703 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1974596..1975567
Genome map
AA seq 323 aa AA seqDB search
MTAVKKIAVLTSGGDSQGMNAAVRAVVRSGLYFGLEVFGIQRGYQGLLNDDIFPMDLRSV
GDIIQRGGTVLQSARCLEFTTEEGQKRGAEILRNRGIDGVVVIGGDGSYQGANKLTKQGI
KTMCLPGTIDNDISFTDYTIGFDTAVSIVVDAINKLRDTMSSHERSSIVEVMGRHCGDIA
LHAGLASGAETILVPEVEFDLNEVSDRMKQNFKHGKRHSIIIVAEGVGKGETVAKVIQEN
CPDYEPRVTVLGHIQRGGTPTAFDRNLASRLGDFAVRQLIEGVSDKACGTIDGKLVATDI
DKVVNTKKDFNMELYELALRLSQ
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagttaagaaaattgcagtattaacaagtggtggagattcacaagggatgaac
gcggcagttcgcgccgttgtgcgtagcggattgtatttcggactcgaagtattcgggatc
caacgcggatatcaaggtcttttgaacgacgatatttttccaatggacctgagaagcgtc
ggagatattatccaacgtgggggtactgtacttcaatctgcaagatgcctggaatttacg
actgaagaaggccagaaacgtggcgctgaaattttgcgtaatcgtggaattgacggcgta
gtcgtaattggtggcgacggttcttaccaaggagctaacaagctgaccaagcaaggcatt
aaaaccatgtgtcttccaggaacgattgacaatgatatttccttcacagactacactatt
ggttttgatacggcggttagtattgtagtggacgcaatcaacaagctgcgtgatacgatg
tcttcccatgaacgttcttccattgtggaagttatgggacgtcattgtggcgatattgct
ctccatgcaggtctggcttccggtgcagaaacgatcttggtacctgaggtggaatttgat
ctgaatgaagtatccgatcggatgaaacaaaacttcaaacatggcaaacgccacagtatc
attatcgttgctgagggtgtaggcaaaggcgaaacagtagcaaaagtaatccaagaaaat
tgtccggattatgagcctcgtgttacagtgcttggacacattcaacgtggaggtacacca
actgcgtttgaccgtaacctcgcaagccgtttgggggactttgctgttcgtcaattgatt
gagggtgtatctgacaaagcttgcggtacgatcgacggtaagctggtagctacagatatt
gacaaggttgtaaataccaaaaaagatttcaacatggagctttatgagttggctctgcgt
ttgtcccaataa

DBGET integrated database retrieval system