KEGG   Paenibacillus polymyxa M1: PPM_1906Help
Entry
PPM_1906          CDS       T01968                                 

Gene name
cheB
Definition
protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:ppo02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:ppo02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2185867..2187411
Genome map
AA seq 514 aa AA seqDB search
MCAYRVLVVDDSAFMRKIITDLIVRDESFNIVGTAANGREAVEKVKELQPDLVTMDVEMP
EMNGLEALPLIMAAHPLPVIMLSGINEQGMKETIMALEAGAFDFIRKPSIAHAQDIEQVS
KALLEQMHTAMQAVRSRLERKEANERKAALEQAKKTPMEKPPGQAVTEKRAGSQASADKP
PVVPLASPPAASAQPKKDAGKSVPTAAKQETKKQLSGTAATADRIDKPAVQPRKPVQAPH
VQKKEDLSMGTGITSGQLKSSEPTAGKSMQGKDKAGLVKPESRKTVTSSASSTPAATTPP
VTAPTVPAAPKGLSLKKGVHTSSFRKLVAVGCSTGGPRALKTLLERIPGDFPAPIVIVQH
MPPNFTRSLAQRLNTLSPLRVVEAEQGMTLETGTAYIAPGGYQLRIVPGAGGKYTVSLKM
EEARNGHRPSVDTMFESLLSLTSLERHLVLLTGMGSDGAKMMKKLYDAGVQSTFAENEET
CVVYGMPRSAVELKCVRHLLPMQEIAPKLVQVVK
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgcttaccgggtgctggttgtagatgattcggcctttatgcgcaaaattattaca
gatctaattgtaagggatgagtcgttcaacatcgtaggtacagccgccaatggcagagag
gctgtagagaaagtgaaagaattgcagcctgatttggtcaccatggatgtcgaaatgcct
gaaatgaatggtcttgaagcgttgccactgattatggcagcccatccgctacctgtcatt
atgctgtcaggcatcaatgaacaaggcatgaaggagaccatcatggctttggaggcaggg
gcttttgattttataagaaagccttccattgctcatgcgcaagatattgagcaggtgagc
aaggcattgctcgaacagatgcatactgctatgcaagcagtacgcagccgcttggagcgc
aaggaagctaatgaacgcaaagctgcattggaacaagcgaaaaaaacgccaatggaaaag
ccacctggacaggctgtgactgagaaacgagctggaagtcaagcttcggcagacaagcct
cctgttgttccgcttgcttctccacctgctgcatcggctcagccaaagaaagatgctggg
aagtccgtcccaacagctgccaagcaggaaactaaaaaacagctgtctggaacagctgct
acagctgatcgcatagacaagccagctgttcagccaaggaaaccagtgcaagcacctcat
gtgcagaagaaagaagacttgtccatgggtacgggaataacgtcgggacaactgaagagc
tctgagccgaccgctggcaaatcgatgcagggtaaggataaagcagggttggtcaagccg
gaatcacggaagacggtaacttcatcagcttcttccactcctgcggctacaacgcctcca
gtaacagcacctacagttccagccgcaccaaagggattgtcacttaaaaaaggtgtacac
acgtccagctttcgaaaactggtggcggtcggatgttctacgggcggaccacgggcgctg
aagacgctgttggagcgcatccctggggattttccagctccaatcgttatcgttcagcat
atgccgccaaacttcactcgttcgctagcccaacggttgaatacgttgagtccactacga
gtggtggaggctgagcaggggatgacgctggagacgggaacagcctacatcgctccaggg
ggatatcagctaagaattgtgcctggagccggtggtaaatacactgtgtcactgaagatg
gaggaggctcgcaatggtcaccgtccttccgtagatacgatgttcgaatcactgctctcg
ttaacctcgctggaaagacatctagtattgcttactggaatggggagcgacggggctaaa
atgatgaaaaagctttatgacgctggggttcaatccacatttgctgaaaatgaggagact
tgtgtagtgtacggaatgccccgctcagcagttgaattaaaatgtgtgcgccaccttctg
ccaatgcaggagatcgcccccaagcttgtacaagttgtgaaataa

DBGET integrated database retrieval system