KEGG   Paenibacillus polymyxa M1: PPM_2298Help
Entry
PPM_2298          CDS       T01968                                 

Gene name
melA9
Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ppo00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ppo00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ppo00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2650202..2652475)
Genome map
AA seq 757 aa AA seqDB search
MNIHVNEALGLFHLQSKDCSYIIQLVEGYPAHVYWGAQLHHDQSLASILELRERCSFSPT
PDSSSRTLSLDTLPQEYPQYGTSDFRQPAYQVALADGTRTTELKYSGYRIEPGKPKLEGL
PSVYTESDDEATTLLLFLEDQHSGLKTTLLYTVFANHSAIARSTLFEHKGSAVMNIEHAM
SASVDFADSNYQALYLSGAWVRERHIQRRDLGPGAIRLESRRGSSSHQMNPFLALLRPDA
TEDRGDVYGFSLIYSSNFVAQAEVEQFNQTRVSIGINPFDFSWRLEPGQSFQTPEAVLVF
SEEGLGGMSRTYHRLYRTRLCRGTYRDKERPILVNNWEATYFDFDADKIEAIAKEAGPLG
IELFVLDDGWFGKRDNDNSSLGDWFEDRRKLPGGLTDLAKRVNEQGLQFGLWVEPEMVSP
DSELYRTHPDWCLHAEGRRRTEGRSQLVLDLSRKEVCDYLYETLSSVFSIAPITYVKWDM
NRNMTEIASATATSERQKEIAHRYMLGLYDLLERLTSRFPDILFESCSGGGGRFDPGMLY
YMPQTWTSDDTDAIERLAIQYGTSIVYPASTMGAHVSNVPNHQVGRNTSLAIRGDVAMSG
NFGYELDLTAFTNEEKELAARQIAQYKEIRSLVQQGDMYRLLSPFEGRGDTAWMFVSEDQ
SEAFVAYFRVLAEPNGPIRRLTLKGLDPAKKYIIETGATGNTSDPINTSTEDGVSPFRLA
FDGEIFGGDRLMKIGLVVSDLTGDFASSTFRLKAISC
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcatgttaacgaggcgcttggtttgtttcacctgcagtccaaggattgcagc
tatattatccagcttgtagaaggatatcctgcacatgtctattggggagctcaacttcat
catgaccaaagtcttgcaagtatattggagcttagagaacgctgttccttctctcccact
cccgattcttccagtcgtacgctttctttggatacgcttccacaggaatatccacagtat
ggaacaagcgacttccgtcagccggcttatcaagttgcgcttgccgatggaactcggact
acagagctaaaatatagtggttaccgtattgaaccgggtaaacccaagctcgaaggactt
ccttccgtctataccgaatcagatgatgaagcaacaactctcttgttgttcctcgaggat
caacactcaggccttaagactacactgctttatactgtgtttgcgaaccacagcgccatt
gctaggtctactctttttgaacataagggaagcgctgtcatgaatattgagcatgcgatg
agcgcctctgtcgacttcgccgattccaattaccaagctctctatttatctggtgcctgg
gttcgggaaagacatatccagcgccgcgatcttgggcccggcgccattcgcttggaaagc
cgacggggctccagcagtcaccaaatgaatccttttctggcactgcttcgtcctgatgca
actgaagatcgtggggatgtgtacggcttcagtctaatttacagcagcaacttcgtcgca
caggcggaagtagagcaatttaatcagactcgtgtaagtatcggaatcaatccttttgac
ttctcctggcggcttgaaccgggtcagtcattccagactcctgaagccgtgctggtcttt
tccgaagaaggtcttggaggcatgtcgcgcacctatcaccggctctaccgcacacgtctg
tgccggggaacttatcgcgacaaggaacgcccgattctcgtgaacaattgggaagccaca
tattttgacttcgacgccgataaaattgaggcgattgccaaagaagcgggacctcttgga
attgagctatttgtccttgatgacggttggtttggcaagcgtgacaacgataacagttcg
cttggagactggttcgaagaccgccgcaagctacctggtggtcttaccgatttggccaaa
cgagttaatgaacaaggattacagtttggcttatgggttgagccggaaatggtatcacct
gatagtgaactgtaccgcacccatcccgactggtgcctgcatgcagaaggtcggcggcgg
acggaaggtcgatcccaattggtgcttgatctctcccgcaaagaagtatgcgattacttg
tacgagacgcttagctccgtattctcgatcgctccaattacttatgtcaagtgggacatg
aatcgtaatatgacggagatcgcttcggctactgctactagcgaacgccaaaaggaaatt
gcgcaccgttatatgctaggactttatgatctgctggaacgcctgacctcacggttcccg
gacatcttgtttgaaagctgttctggcggaggcggacgattcgatccagggatgctctac
tatatgccgcagacatggaccagtgatgacactgatgctattgaaagattggcgatccag
tacggcaccagcatcgtgtatccggccagtactatgggggcccacgtatcgaacgtgccg
aaccaccaggtgggacgaaacacctccctcgccatacgtggcgacgtggcaatgagcggg
aattttggctacgaacttgaccttactgcatttacaaatgaagaaaaagagctcgctgcc
agacaaattgcccagtataaagaaatccgctcccttgtacagcagggagatatgtatcga
cttcttagtccgtttgaaggccgaggcgatactgcctggatgtttgttagcgaggaccag
tccgaagcttttgtcgcttacttccgtgtgctggctgagccaaatggacctatccggcga
ctaacgctaaaaggacttgacccagccaaaaagtatataatcgaaaccggtgcgaccggc
aatacttcagatcctattaatacctcgactgaagatggcgtttcccctttccgtctagcg
tttgacggcgaaatttttggaggtgaccgcttaatgaaaattgggcttgttgtctcggat
cttactggggattttgccagctctaccttccgccttaaagcgatctcttgctaa

DBGET integrated database retrieval system