KEGG   Paenibacillus polymyxa M1: PPM_2686Help
Entry
PPM_2686          CDS       T01968                                 

Gene name
mutM3
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ppo03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3153774..3154592)
Genome map
AA seq 272 aa AA seqDB search
MPELPEMENYRILLSKQILDIPITGVTVSREKSINTEVETFKKQLLGATVVYLERRGKHL
IFHLNTGKRLVLHLMLGGLLYLGTEEQRPDRTIQIELDFSGVKLYFIGLRLGYLHLLTAK
ETDEALSDLGPDPLDRRMTLENFTARLKGRRGILKTTLVNQQVFSGIGNCYSDEIAYIAG
FTPGSKVQNIVQSPEKVEKLYHATQSVLREATAEGGYMEMPLMEGDTLTGGFDHQCRVYD
REGEESPSGGKIVRVELAGKKAFYCPVQQHDA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgccggaacttcctgaaatggaaaactacagaatcttattgtcaaaacaaattttggac
attccgattactggagtgacggttagccgcgaaaagtccattaatactgaagtggaaacc
tttaaaaagcaattgctgggtgcaaccgttgtatatttagagcgtcggggtaagcatttg
atttttcatttaaacacgggtaaacgacttgtgcttcatctaatgttgggaggactgttg
tatctgggaacggaggagcaacgtccagaccgtacgattcagatcgaattggattttagc
ggagtgaagctttattttatcggactgcgcttaggttatctgcacttgctgacggctaaa
gaaacagatgaagctttgtcagacctgggaccagatccgttagaccgtcgtatgacgttg
gagaattttacagcacgtctaaaaggacgacggggaattttgaaaacaacactggtaaat
cagcaggttttttcggggattggaaactgctattcggacgaaattgcttatatcgccgga
tttacaccgggttccaaggtacaaaatattgtacagtctccagaaaaagtggaaaagcta
tatcatgctactcaatccgtacttcgtgaagctactgcggagggcggttatatggaaatg
cctctaatggagggagacacgctaacaggtggctttgatcatcagtgtcgagtatatgac
cgtgaaggagaagaatctccaagcggtgggaaaattgtaagagtcgagctggcgggaaaa
aaagcattttattgcccggtgcagcagcatgatgcctaa

DBGET integrated database retrieval system