KEGG   Paenibacillus polymyxa M1: PPM_2878Help
Entry
PPM_2878          CDS       T01968                                 

Gene name
proB
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ppo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PPM_2878 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PPM_2878 (proB)
Enzymes [BR:ppo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     PPM_2878 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3354836..3356041
Genome map
AA seq 401 aa AA seqDB search
MKVVPRKHKLSSFAYKGWKFFCIKKSKIKEVDVLSTRIVIKIGSSSLTGVEGGLNREAIA
YFAREISLLRAKGHEVLLVTSGAVAAGFREIGYPFRPKLLHEKQAAAAVGQALLMQAYEQ
AFKNFDLVIAQVLLTRSDFLSRKRMNNAGMTVEELLRQQVIPIFNENDTVSIDELKFGDN
DMLSALVANLVKAQHLIIITDTDGVYTADPRKHPNAVRFERIEEITEEIYALAGGSGSAV
GTGGMRSKIEAAKVATRGGVPVYVGRVSANGDLNAAVEGHGPGTYFDTHLSSLPMKKQWL
GFMSTPLGSVHVDQGAEEALVHGGHSLLPVGVRRVEGSFHAGDVVEVLGPENKVLGRGIV
NYDDEQLRMVQGLPSGEVVGKIGPIHRLEVIHRDEWITLCM
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtggtaccgcggaagcacaaactttcgtcctttgcatacaaaggatggaagttt
ttttgcattaaaaagagtaaaattaaggaagtggacgtcttgtcaacacgtatcgtcatt
aaaatcggtagcagctcactgactggagtggaaggtggcctgaatcgggaagccatcgct
tattttgctagggaaatcagcttgcttcgtgcaaaaggccatgaagtgctgctggttaca
tcaggcgctgtagccgccggattccgagagattgggtatccctttcggcccaaactgctg
catgagaagcaagcggcagctgccgtcggccaagctcttctcatgcaagcctatgagcag
gcttttaaaaattttgacctcgtgatcgcgcaggttctgctcacccgtagtgacttttta
agccgcaaacggatgaacaacgccggaatgactgtagaagaattgctgcgccagcaggtt
atcccgatttttaatgaaaatgacaccgtatcgattgacgaattaaaattcggcgataac
gatatgctgtctgcactagttgccaatctggtcaaagcccagcatttgattatcatcacg
gataccgatggtgtatatacggctgacccgcgcaagcatccaaacgccgtacgttttgaa
cgtatcgaggaaattactgaagagatttatgcattagccggaggttctggatcagcagta
gggactggcggcatgcgctccaaaatcgaggctgccaaagttgctacacgcggcggtgtg
cctgtatatgtcggccgagtaagcgcaaatggtgatctgaacgcagctgtcgaaggacac
ggaccgggcacttattttgatacccacctctcttcactgccgatgaaaaaacaatggctt
ggatttatgtccacccctctgggctcggtgcatgtagaccaaggggccgaagaagcgttg
gtacacggaggacatagtctgcttccggttggcgtacggcgtgtcgagggcagctttcat
gccggagatgtcgttgaggtactgggaccggaaaacaaggtgttaggacgaggcatcgtc
aattatgatgatgaacagcttagaatggtacaaggtttacctagcggcgaggttgtgggc
aaaattggtcccatccatcggcttgaggtgatccacagggatgaatggattacattatgt
atgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system