KEGG   Paenibacillus polymyxa M1: PPM_2925Help
Entry
PPM_2925          CDS       T01968                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
ppo00260  Glycine, serine and threonine metabolism
ppo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ppo01100  Metabolic pathways
ppo01110  Biosynthesis of secondary metabolites
ppo01130  Biosynthesis of antibiotics
ppo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ppo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PPM_2925 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PPM_2925 (trpA)
Enzymes [BR:ppo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PPM_2925 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA His_biosynth PcrB PucR
Motif
Other DBs
NCBI-ProteinID: CCC85862
Position
complement(3401322..3402128)
Genome map
AA seq 268 aa AA seqDB search
MNLIDQAFERLKNEGKTALIPFLTVGDPDVDTTIEIIRQLESAGADILELGVPYSDPLAD
GPVIQRASERALKRQISIRTCMETASLARAAGSNLPFILFTYYNPVLQMGMDAFFAGLQE
HGISGLIIPDLPLEEAEELGGRAAEVGVHLIPLVAPTSEQRIERIARQARGFVYCVSSLG
VTGERASFFEGIEGFIAQVKRHTSVPVAIGFGISNRKQIVRFSDICDGVVVGSAIVRQVE
EAIPLLEDSARREEGLLQIRDFVAQLKQ
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaattgatcaggcgtttgaacgccttaaaaatgaaggcaaaacggcattaatt
ccttttctgacggtaggcgacccggacgtagatactacgatagagatcattcggcagtta
gagtcggccggagccgatatattggaactaggcgtaccttattcggatccgttggctgac
ggtcctgtgattcagcgtgcgtctgaacgtgcattgaaacggcaaatttcgatccgcacc
tgtatggagaccgcgtctctggctagagcggcaggttcaaacctgccttttattctgttc
acatattataatcctgtattgcagatgggaatggatgctttctttgctggcttgcaggag
cacggtatcagtggtcttattattccggatcttccacttgaagaagcagaagagttggga
ggacgtgcagcagaggtgggtgtgcatctgatcccgctggtagccccaacgtctgaacag
cgtatcgaacgaattgcccgtcaggcccgtggatttgtatactgtgtatcttcgctgggt
gtaaccggagaaagagcttctttttttgaaggtatagagggctttatcgcgcaggtcaaa
cggcataccagtgttccggtggcgataggctttggtatttcaaatcgtaagcagattgtc
cggttttcagacatttgcgatggagttgtggttggcagtgccattgtgcgccaggtggag
gaagccattccattgctggaggattctgcacgcagagaagaagggcttttgcaaattcgt
gattttgtggcacaattaaagcagtaa

DBGET integrated database retrieval system