KEGG   Paenibacillus polymyxa M1: PPM_2926Help
Entry
PPM_2926          CDS       T01968                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ppo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PPM_2926 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PPM_2926 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PPM_2926 (trpB)
Enzymes [BR:ppo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PPM_2926 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3402125..3403321)
Genome map
AA seq 398 aa AA seqDB search
MTQLPDNNGRFGTFGGRYVPETLMNALIELEESYRKYADDPEFKAELNGLLKDYSGRETP
LYHAERLSQHLGGAKIYLKREDLNHTGAHKINNALAQGLLAKRMGKQKVIAETGAGQHGV
ATATVAALLGLECKVFMGEEDTVRQQLNVFRMQLLGAEVIPVTSGTRTLKDAGNEALRYW
VSHVHDTFYILGSAVGPHPYPMMVRDFQRVIGDETRRQILEKEGRLPDVVVAAIGGGSNA
IGMFYPFIEDQGVALIGVEAAGKGVETEFHAATMSKGTQGVFQGSMSYLLQDEYGQVQPA
HSISAGLDYPGVGPEHSYLKDIERAQYVPITDQEALDALQLLCRTEGILPALESAHAVAQ
VAKLAPTLTADDIIVICLSGRGDKDVDSIIKYLGGNPS
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgacacaattacctgataacaacggacgttttggaacttttggcggacgttatgtaccg
gaaacgttgatgaacgcactgattgaattggaggaatcctaccgaaagtatgcggatgat
cctgaatttaaagcagagttgaatggacttctaaaagactattcgggtcgggaaacgccg
ctttatcatgcggagcgactgagtcaacatctgggcggggctaaaatttacttgaagcgc
gaagatttaaaccatactggcgcccataaaattaataatgcattggcccagggattgctg
gcgaagcgtatgggtaagcagaaggttattgccgaaacaggtgctggacagcatggtgtt
gcgacggctactgtggctgcattgctcggattggaatgcaaggtgtttatgggggaagag
gatacagttcgccagcagttgaatgtatttcggatgcagcttttgggtgcagaagtgatt
ccggtgacatccggtacgcgtacactgaaggatgccgggaatgaagctttgcgttattgg
gtgagccacgtccatgatacgttctatattttgggttcggctgtcggcccacatccgtat
ccgatgatggtgcgggacttccaacgtgtgataggcgatgaaacacgccgtcagatcttg
gagaaggaaggtagacttccggatgtagtcgtggcagcgatcggtggtggaagcaatgct
atcggcatgttttatccttttatagaggatcagggtgtcgctttgattggcgtggaggct
gctggaaaaggcgtcgagacggaattccatgcagctaccatgagcaagggaacacaaggg
gtcttccaaggctctatgagttatctgcttcaggatgagtacggacaagtgcagcctgcg
cattccatctcggctggactggattatccaggtgttggaccggagcattcatacctaaaa
gatattgagcgggcccaatatgttccgattaccgatcaggaagcactagatgcacttcag
ctcctttgccgtaccgaaggaatacttcctgcattagagtcggcgcatgccgttgcacag
gtcgccaagctggcacctacattgaccgcagatgatattatcgttatttgtttgtctggg
cgcggggataaagatgtggactccatcatcaagtatttagggggaaatccgtcatga

DBGET integrated database retrieval system