KEGG   Paenibacillus polymyxa M1: PPM_2986Help
Entry
PPM_2986          CDS       T01968                                 

Gene name
porG
Definition
(GenBank) pyruvate ferredoxin oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
ppo00010  Glycolysis / Gluconeogenesis
ppo00020  Citrate cycle (TCA cycle)
ppo00620  Pyruvate metabolism
ppo00640  Propanoate metabolism
ppo00650  Butanoate metabolism
ppo00680  Methane metabolism
ppo01100  Metabolic pathways
ppo01120  Microbial metabolism in diverse environments
ppo01130  Biosynthesis of antibiotics
ppo01200  Carbon metabolism
Module
ppo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ppo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPM_2986 (porG)
   00020 Citrate cycle (TCA cycle)
    PPM_2986 (porG)
   00620 Pyruvate metabolism
    PPM_2986 (porG)
   00640 Propanoate metabolism
    PPM_2986 (porG)
   00650 Butanoate metabolism
    PPM_2986 (porG)
  Energy metabolism
   00680 Methane metabolism
    PPM_2986 (porG)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    PPM_2986 (porG)
Enzymes [BR:ppo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     PPM_2986 (porG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR Fer4_7 Fer4 Fer4_6 Fer4_10 Fer4_16 Fer4_2 Fer4_9 Fer4_17 Fer4_4 Fer4_21 Fer4_8 Fer4_3
Motif
Other DBs
NCBI-ProteinID: CCC85923
Position
complement(3457791..3458804)
Genome map
AA seq 337 aa AA seqDB search
MSILTRTNRLGFFEIRLESIGGLGANLAGKMLAETGVLGLGLNASNFSSYGSEKKGSPVK
SFVRFCEPEVDIRDHSPIEQPHVVGIFHETLYKTVNVISGLPADGIVVVNSTRPAEEIRA
DLGLVSGTLAVVDAMGIALEERTKLNTSMLGALFRVCDFLDPEAMRSVIRSTFEKKNPQL
VEPNLRTFNRGFEEMQLHVYPVTADAQDRVFERPQPLLGYETQLLGGVIATQGNSMTKDV
SGSRQGYVPEYEADKCTHCAKCDSICPDYCFVWEEQADKRGRMMPFLQGIDYQYCKGCLK
CVDICPSGALSSRREQWGWAEQNRVAHQFPVYEGGRA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
ttgtctattttaacgcgcacaaatcgactcggattttttgaaatccggctggaatccatt
ggtggactcggcgcaaatctggctggcaaaatgttggccgaaaccggggtacttggtctg
ggactgaatgcttcaaatttctcatcctacggttcggaaaagaagggatctccagttaaa
agctttgttcgcttctgtgagccggaggtggatattcgcgatcacagtccgatcgagcaa
ccgcatgtggtaggcattttccatgaaacgttatacaaaacggtaaatgtaatcagcggc
ctgccagcagatgggattgtagtggtcaattccacacgtccggcagaagaaatacgggct
gatttgggactggtatccggtacattagcagtggtggatgcgatgggcatcgcactggaa
gagcggaccaaactaaatacgtccatgctaggtgccttgttccgtgtctgtgatttcctg
gacccggaagcaatgagatcggttattcgcagtacttttgaaaagaaaaatccacaatta
gtggaacctaatctgcgtacgtttaatcgtggttttgaagaaatgcaactacatgtatat
ccggttactgctgatgcgcaggatcgggtttttgaacgtccgcagcctttgctagggtac
gaaactcaattgctggggggcgttattgcaactcagggcaacagcatgacgaaagatgtt
agtggttcacgtcagggttatgtacctgagtatgaagctgataaatgtactcattgtgcc
aagtgtgattcgatttgcccggattactgctttgtatgggaagagcaagcagacaaacgc
ggaagaatgatgccgtttttgcaagggattgattaccagtattgcaaagggtgtctgaag
tgtgtagatatttgcccgtcaggggcattaagctcgcgtcgcgaacaatggggctgggcg
gagcagaatcgcgttgcccaccaatttccagtatatgaaggagggcgtgcgtaa

DBGET integrated database retrieval system