KEGG   Paenibacillus polymyxa M1: PPM_3064Help
Entry
PPM_3064          CDS       T01968                                 

Gene name
adhE
Definition
(GenBank) alcohol dehydrogenase / acetaldehyde dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
ppo00010  Glycolysis / Gluconeogenesis
ppo00071  Fatty acid degradation
ppo00350  Tyrosine metabolism
ppo00620  Pyruvate metabolism
ppo00625  Chloroalkane and chloroalkene degradation
ppo00626  Naphthalene degradation
ppo00650  Butanoate metabolism
ppo01100  Metabolic pathways
ppo01110  Biosynthesis of secondary metabolites
ppo01120  Microbial metabolism in diverse environments
ppo01130  Biosynthesis of antibiotics
ppo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ppo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPM_3064 (adhE)
   00620 Pyruvate metabolism
    PPM_3064 (adhE)
   00650 Butanoate metabolism
    PPM_3064 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    PPM_3064 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    PPM_3064 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PPM_3064 (adhE)
   00626 Naphthalene degradation
    PPM_3064 (adhE)
Enzymes [BR:ppo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PPM_3064 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     PPM_3064 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 AphA_like
Motif
Other DBs
NCBI-ProteinID: CCC86001
Position
complement(3536557..3539169)
Genome map
AA seq 870 aa AA seqDB search
MAVKNEVIQKEQSAEQYIQTLIDRANRAQQAFMSMNQEQIDGIVQAMALAGMDKHMHLAK
LAVEETGRGVYEDKITKNMFATEYIYHSIKNEKTVGVIEDNDFDSFQKIAEPVGIIMGIT
PVTNPTSTTMFKALIAIKTRNPIIFGFHPSAQSCSAEAARVLLEAAVKHGAPADCIQWIE
APSMDKTNVLMNHPDVALILATGGSGMVKAAYSCGKPALGVGPGNVPCFIEKTADIKQAV
NDLILSKSFDNGMICASEQAVIIEEPIFEQVKKLMIANGCYFVNKEEAAKLTQGAMNVEK
CAVNPAIVGQSAVKIAEMSGITVPAGTKILVAEIEGVGTKFPLSAEKLSPVLACYKVKNA
EQGIQRAAEVVEFGGMGHSSAIHSQDEDVIARFANRLQTGRIIVNAPSTHGAIGDIYNTN
LPSLTLGCGSYGRNSTSSNVSAVNLINVKRVAKRTVNMQWFKVPSKIYFEKNSTQYLAKM
PDITRVAIITDPMMVKLGYVDRVIHYLHQRQTPVAIEVFSEVEPDPSTVTVERGTEMMRR
FQPDCIIALGGGSPMDAAKGMWMFYEYPDTDFNNLKQKFMDIRKRIYKYPRLGQKAQFVA
IPTTSGTGSEVTSFAVITDKNLGNTKYPLADYELTPDVAIIDPVFVYSLPKTAVADTGMD
VLTHAIEAYVSVMANDYTDGLAIKAIQLVFQYLEQSALIGDKLAREKMHNASTLAGMAFA
NAFLGINHSLAHKWGGQYHTAHGRTNAILLPHVIRYNAKKPTKFASFPKYSHFVADERYA
EIARILGLPARTTEEGVNSLIDAIRKLNKTLGIEESFQQLGFDPKDFESRVDYLADRAFE
DQCTTANPKLPLVTELADVYRNAFYGRFDQ
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atggctgttaaaaacgaggttatccaaaaagagcaaagcgcagagcagtatattcaaacg
ctgattgaccgggcgaaccgggcacagcaagctttcatgagtatgaatcaggagcagatt
gacggaatcgtacaagctatggcactcgcagggatggataagcacatgcacctagcgaag
ttggctgttgaagaaacaggacgcggtgtgtacgaggacaaaatcaccaaaaacatgttt
gcaacagaatatatctatcacagcatcaaaaatgagaagaccgttggtgtcattgaagat
aatgatttcgatagcttccaaaagattgcagagccagtcggtatcatcatggggattact
ccagtaacaaacccgacttcgactacgatgttcaaagcgttaattgccattaaaacacgt
aacccaatcattttcggcttccatccatctgctcaatcgtgtagtgcggaagcagcccgc
gtcttgcttgaagcagctgttaaacatggtgctccagcggattgcatccaatggattgaa
gcaccttcgatggataaaacaaatgtactgatgaaccaccctgatgtggcattgattttg
gcaactggcggatcaggcatggttaaggcagcttatagctgtggtaaacctgcacttggc
gtaggtcctggtaacgtaccttgctttattgaaaaaacagccgatatcaaacaggccgtg
aacgaccttatcctttctaaatcttttgataacggtatgatttgtgcttcggaacaagcc
gtaattatcgaagagcctatcttcgagcaagtgaagaaattgatgattgctaatggttgc
tactttgtaaataaagaagaagcagctaagctcactcaaggggctatgaatgtagaaaaa
tgtgcagtgaacccggccatcgtcggacagtctgctgtaaaaatagctgaaatgagcggc
attacagtaccggcaggaacaaaaattttggtcgctgaaattgaaggagtaggaaccaaa
ttcccattatctgcggaaaaattgagtccggtattggcttgctacaaagtgaaaaatgca
gagcaaggtatccaacgtgctgctgaagttgtagagttcggcggtatgggtcactcgtca
gctatccattcgcaagatgaggacgttatcgctcgctttgcaaaccgtttgcaaacaggt
cgtatcattgtaaatgcaccttccacacatggtgcaatcggtgatatttacaacaccaac
cttccttcgttgacacttggttgcggttcgtacggtcgtaactcgacttcgtcgaacgta
tctgcagttaacttgattaatgtgaaaagggtggcgaaacggacggtgaatatgcaatgg
ttcaaagtaccttccaaaatttattttgagaaaaattcgacacagtatcttgctaaaatg
cctgatatcacacgtgtagccattatcactgaccctatgatggtgaaactcggatatgtg
gaccgcgtcattcattatttgcaccagcgccaaacaccagttgcgattgaagtgttctct
gaagttgagccagatccatcgacagttacggtagagcgtggtactgaaatgatgagacgt
ttccaaccggattgcatcatcgcactcggcggcggttcgccaatggatgctgctaaaggc
atgtggatgttctatgaatatccggatactgatttcaataacttgaagcaaaaattcatg
gatattcgtaaacggatttacaagtacccacgtctgggtcaaaaagcacaatttgtagct
atccctacaacctcgggtacaggttcggaagtcacatcgtttgcagtaattacagacaaa
aacctgggcaacacgaagtatccgctggctgactatgagttgactcctgatgtggcaatt
attgaccctgtgtttgtatattcgctgcctaaaacagctgtagccgatacaggtatggac
gttctgacacatgctatcgaggcttacgtgtctgtaatggccaatgattacacagatggt
ctggcaattaaagccattcaactggtattccaatacctggagcaatcggctctgatcggc
gacaagttggctcgcgaaaaaatgcataatgcttctacacttgcaggtatggcgtttgct
aatgcattcttgggtattaaccacagtcttgcacataaatggggcggacaataccatacg
gcgcatggccgcacgaatgctatcttgctgccgcacgttattcgctacaatgcgaaaaaa
ccgacaaaatttgcttcgttccctaaatattcgcactttgttgcagatgagcgctatgca
gaaattgcacgcatactgggactgcctgcacgtaccactgaagaaggggttaacagctta
attgacgcgatccgtaagttgaacaaaacactcggtatcgaggaatcgttccaacaactc
ggattcgatccaaaagactttgaatcacgtgtagattatctggctgaccgcgcttttgag
gatcaatgtacaactgcaaatccaaagctgccgctggttactgaattggctgatgtatac
cgcaatgccttctacggacgctttgatcaataa

DBGET integrated database retrieval system