KEGG   Paenibacillus polymyxa M1: PPM_3251Help
Entry
PPM_3251          CDS       T01968                                 

Gene name
PME2
Definition
Pectinesterase-2 PE 2 (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PPM_3251 (PME2)
   00500 Starch and sucrose metabolism
    PPM_3251 (PME2)
Enzymes [BR:ppo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     PPM_3251 (PME2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3789101..3790078)
Genome map
AA seq 325 aa AA seqDB search
MLVGKESFCDFHTIQEAINVLEQSPSNEMETLTILSGTYEEEVRIYRSNLHIIGIGQVEI
RMNRYARERNESGEEIGTFATPTLFVGGSHLILENLIISNTAGQGEHIGQAVAVYAHCDQ
TIFRNCTFKGYQDTLFTGPLPPAPKERLKFGGIPLKEHHAYYRQLYQHCYIEGTIDFIFG
GATAYFEDCEIRSLRHHKNHTSYVTAASTPQGQTYGYVFDHCYLTAEPDITPVFLGRPWR
EYAKTVFVNCKMGDHIDPRGWDNWDTVANEKTVCYQEYGGSDEIASLRQQRVPWADCFEA
RTEAWSKEQVFEGVAFWKARRSDVS
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgctagtcggaaaagaatccttttgtgatttccacaccattcaggaggcgattaatgta
ttggagcaatcgccttccaacgaaatggaaacgctaactattttatcgggtacctatgag
gaagaggtgcggatttaccgttcaaatctacatatcataggcatcggacaggtagaaatt
cgaatgaatcggtacgccagggagcggaatgaatcaggtgaggaaataggaacctttgca
acacccactttatttgtaggcggcagccatttgatcttggaaaatctcatcatttccaac
acggccggacagggagaacacattgggcaggccgttgcggtatacgctcattgtgatcaa
accatctttagaaactgcacctttaaagggtaccaggacacgttatttacaggccctctg
cctcctgcacccaaagaacgattaaagtttggtggaattcctttgaaagaacatcacgca
tactatcgccagctttatcagcattgttacatcgagggtacgatagacttcatttttggc
ggggctaccgcttactttgaagattgcgagattcgtagtttgcgtcatcataagaaccat
acaagctacgttacagccgcctctacaccgcaaggacaaacgtacggctatgtatttgat
cattgctatttaaccgcagagcctgatattacccctgtttttttgggtcgtccatggcgg
gaatatgccaaaaccgtatttgtcaattgtaaaatgggcgaccatatcgatccgcgtggc
tgggacaattgggacactgtagcgaacgagaaaaccgtatgctatcaggaatatggcgga
tctgatgaaatagcttcattacgtcagcagcgtgttccgtgggcggattgttttgaagcg
aggacagaagcatggagcaaggaacaggtttttgagggagtcgcattttggaaagcaagg
agaagtgatgtctcatga

DBGET integrated database retrieval system