KEGG   Paenibacillus polymyxa M1: PPM_3628Help
Entry
PPM_3628          CDS       T01968                                 

Gene name
hemY3
Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
ppo00860  Porphyrin and chlorophyll metabolism
ppo01100  Metabolic pathways
ppo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PPM_3628 (hemY3)
Enzymes [BR:ppo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     PPM_3628 (hemY3)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     PPM_3628 (hemY3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 Pyr_redox_2 DAO NAD_binding_9 HI0933_like Pyr_redox AlaDh_PNT_C Trp_halogenase MCRA Thi4 FAD_oxidored OmpH
Motif
Other DBs
NCBI-ProteinID: CCI70437
Position
complement(4192056..4193528)
Genome map
AA seq 490 aa AA seqDB search
MIHIVHICLEWGRKRALMNKNAKKVVILGGGISGLSAAFYVKKLAEDRQLEVEITLVEKS
DRLGGKLQTVRQNHFMIEKGPDAFLARKTAILDLTMELGLEADLVSTNPKAKSASILHKG
KLHTMPMGFILGIPTKLTPFIRTGLISPLGKARAAMDLIIPAKKGDMDESLGDFIKRRLG
KEVLEQITEPLLSGIYAGDTYSLSLKSTFPQFKQMEQKHGSLIIGMAKGAGRKSGAPNKL
PEIAKKSMFLSYRHGLSTIVERLKEKLDTVQFVMEQRVAEIRKENGYQVVLNQGQIIDAD
AIICAIPAFEAAKLFSDITSVSWLNKINYVSVANISLAYKNSDLRLAYEGTGFLVPRKEG
KMITACTWSSTKWSHTAPEGYTLLRTYIGHAGAQEWVQMTDEELVEAARKDLKDLMGIDA
QPKMTEVSRCNQSMPQYPIGHQEQMAKVRHDLSQYFPNVFLCGAGYGGVGIPDCIAQGKE
AAEQLVSGFL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
gtgatccatattgtgcatatatgcctggagtggggaaggaaacgtgcgcttatgaataaa
aatgctaaaaaagttgtgatccttggtggaggaataagcggtttaagtgccgctttttat
gtgaaaaagctggcagaggacaggcagcttgaagtggagattacactggtggagaaaagc
gaccgcctgggaggaaagctgcaaacggttcgccaaaaccattttatgatcgaaaaagga
ccagatgctttcctggccagaaagacggctatattggatctgactatggagttgggactg
gaagctgatttggtgtcaacaaacccgaaggccaagtcggcctccattttgcataaaggc
aagctgcataccatgccgatgggctttattttaggtattccaaccaagctaactcccttc
attcggacagggctaatttctccattgggaaaagcgcgcgcagccatggatttgatcatt
ccagccaagaaaggcgatatggatgaatctctgggagattttatcaagcggcgtctaggt
aaagaggtgttggagcagattacagagcctttgttatctggtatttacgctggcgatacg
tattctcttagcctcaagtcaaccttccctcaatttaagcagatggaacaaaagcatgga
agtctgattataggtatggctaaaggggcggggagaaagtcgggtgcacctaacaaattg
ccggaaatcgccaagaaaagcatgtttctttcctatcgacatggattatcgaccatcgtg
gagcggttaaaggaaaagctcgacactgtccaatttgtgatggagcagcgtgtggctgag
ataagaaaagagaacggttatcaggtagtcctgaaccaaggacaaatcatagatgcagat
gcaataatctgcgctattccagcctttgaggcggctaaattattttccgatatcacaagt
gtgagctggcttaataagatcaattacgtttcggtagcgaatatttccttggcgtataaa
aattcagaccttcgcctggcctatgagggaactggatttctcgttccccgtaaggaaggg
aagatgattacggcctgtacttggtcatctacaaagtggagccataccgcacctgaaggg
tatacactcttgcggacttacattggccatgcaggtgcacaggaatgggttcagatgaca
gacgaggaactagtggaagcagcccgcaaagacctgaaagatctaatggggatcgatgct
caacctaaaatgaccgaggtcagtcggtgtaatcaatccatgccacaatatccgattggg
caccaagaacagatggcgaaggtgagacatgatttgtcacagtattttccgaatgtgttt
ctttgtggcgctggttatggaggcgttggcattccagattgtatcgctcaaggcaaagaa
gcagctgaacagctggtctcaggtttcttataa

DBGET integrated database retrieval system