KEGG   Paenibacillus polymyxa M1: PPM_3722Help
Entry
PPM_3722          CDS       T01968                                 

Gene name
celA3
Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ppo00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4287500..4288693
Genome map
AA seq 397 aa AA seqDB search
MKKKGLKKTFFVIASLVMGFTLYGYTPPSADAASVKGYYHTQGNKIVDESGKEAAFNGLN
WFGLETPNYTLHGLWSRSMDDMLDQVKKEGYNLIRLPYSNQLLDSSSRPDSIDYYKNPDL
VGLTPIQIMDKLIEKAGQRGIQIILDRHRPGSGGQSELWYTSQYPESRWISDWKMLAERY
KNNPTVIGADLHNEPHGQASWGTGDVSTDWRLAAQRAGNAILSVNPNWLILVEGVDHNVQ
GNNSQYWWGGNLTGVANYPVVLDVPNRVVYSPHDYGPGVSSQPWFNDSTFPSNLPAIWDQ
TWGYISKQNIAPVLVGEFGGRNVDSSSAEGKWQNALVDYIGANNLYFTYWSLNPNSGDTG
GLLLDDWVTWNRPKQDMLSRIMKPVNFIAEQVKASAE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaaagggttgaaaaaaacatttttcgtcattgcctccctcgtcatgggcttc
acactgtatgggtacactccaccttcggcagatgcagccagcgtgaaaggatattatcat
acccaaggaaacaagattgtagatgaatccgggaaagaggccgcatttaacggtctgaac
tggtttggtctagaaacccctaattacactttgcatggactgtggagccgctcaatggac
gacatgctggatcaggtgaagaaggaaggttataatctcatccgtctgccttacagcaat
cagttattggattccagctctcgtccggacagtattgattactacaaaaatcctgatctg
gtcggattgactccgattcaaattatggacaagctgatcgaaaaagctggacaacgcggt
attcagattatccttgaccgtcaccgcccaggctcaggtggacaatccgagctatggtat
acctctcagtaccctgagtcccgctggatcagcgactggaagatgttagctgaacgttat
aaaaacaatcctaccgtcattggtgcagatttacacaacgaaccgcacggtcaggcaagc
tggggaacaggcgatgtttccacagactggcgtctcgcggcgcagcgtgcagggaatgcc
attctgtctgtgaatccgaattggctgattctggtagaaggtgtggaccataatgtacaa
ggcaacaacagccaatattggtggggcggcaacctgacaggtgtagccaactatcctgtc
gttctggacgtaccgaaccgtgtcgtctattcaccacatgactacggtcctggtgtgtct
tcgcagccatggttcaacgattcaaccttcccgtccaacctgccagcaatctgggatcaa
acctggggctacatcagtaagcaaaacatagctccggtgctggtcggtgaattcggcggt
cgcaatgttgattcgtcttccgctgagggtaaatggcaaaatgcactcgtagactatatt
ggtgccaataacctgtactttacgtattggtccctgaatccgaatagcggcgatacaggt
ggtctgctgctggatgactgggttacctggaaccgtccgaagcaggacatgctgagccgg
attatgaagcctgtaaatttcatagcagagcaagtgaaagcaagcgccgaatag

DBGET integrated database retrieval system