KEGG   Paenibacillus polymyxa M1: PPM_3722Help
Entry
PPM_3722          CDS       T01968                                 

Gene name
celA3
Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ppo  Paenibacillus polymyxa M1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PPM_3722 (celA3)
Enzymes [BR:ppo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     PPM_3722 (celA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4287500..4288693
Genome map
AA seq 397 aa AA seqDB search
MKKKGLKKTFFVIASLVMGFTLYGYTPPSADAASVKGYYHTQGNKIVDESGKEAAFNGLN
WFGLETPNYTLHGLWSRSMDDMLDQVKKEGYNLIRLPYSNQLLDSSSRPDSIDYYKNPDL
VGLTPIQIMDKLIEKAGQRGIQIILDRHRPGSGGQSELWYTSQYPESRWISDWKMLAERY
KNNPTVIGADLHNEPHGQASWGTGDVSTDWRLAAQRAGNAILSVNPNWLILVEGVDHNVQ
GNNSQYWWGGNLTGVANYPVVLDVPNRVVYSPHDYGPGVSSQPWFNDSTFPSNLPAIWDQ
TWGYISKQNIAPVLVGEFGGRNVDSSSAEGKWQNALVDYIGANNLYFTYWSLNPNSGDTG
GLLLDDWVTWNRPKQDMLSRIMKPVNFIAEQVKASAE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaaagggttgaaaaaaacatttttcgtcattgcctccctcgtcatgggcttc
acactgtatgggtacactccaccttcggcagatgcagccagcgtgaaaggatattatcat
acccaaggaaacaagattgtagatgaatccgggaaagaggccgcatttaacggtctgaac
tggtttggtctagaaacccctaattacactttgcatggactgtggagccgctcaatggac
gacatgctggatcaggtgaagaaggaaggttataatctcatccgtctgccttacagcaat
cagttattggattccagctctcgtccggacagtattgattactacaaaaatcctgatctg
gtcggattgactccgattcaaattatggacaagctgatcgaaaaagctggacaacgcggt
attcagattatccttgaccgtcaccgcccaggctcaggtggacaatccgagctatggtat
acctctcagtaccctgagtcccgctggatcagcgactggaagatgttagctgaacgttat
aaaaacaatcctaccgtcattggtgcagatttacacaacgaaccgcacggtcaggcaagc
tggggaacaggcgatgtttccacagactggcgtctcgcggcgcagcgtgcagggaatgcc
attctgtctgtgaatccgaattggctgattctggtagaaggtgtggaccataatgtacaa
ggcaacaacagccaatattggtggggcggcaacctgacaggtgtagccaactatcctgtc
gttctggacgtaccgaaccgtgtcgtctattcaccacatgactacggtcctggtgtgtct
tcgcagccatggttcaacgattcaaccttcccgtccaacctgccagcaatctgggatcaa
acctggggctacatcagtaagcaaaacatagctccggtgctggtcggtgaattcggcggt
cgcaatgttgattcgtcttccgctgagggtaaatggcaaaatgcactcgtagactatatt
ggtgccaataacctgtactttacgtattggtccctgaatccgaatagcggcgatacaggt
ggtctgctgctggatgactgggttacctggaaccgtccgaagcaggacatgctgagccgg
attatgaagcctgtaaatttcatagcagagcaagtgaaagcaagcgccgaatag

DBGET integrated database retrieval system