KEGG   Paenibacillus polymyxa CR1: X809_03005Help
Entry
X809_03005        CDS       T02956                                 

Definition
glycosyl hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
ppol  Paenibacillus polymyxa CR1
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppol00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    X809_03005
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    X809_03005
Enzymes [BR:ppol01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     X809_03005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(651412..652755)
Genome map
AA seq 447 aa AA seqDB search
MSNQTIQWFSTSKAKAWQSQAHHLTDTQDSANLTLTGETHQLVEGFGGCFNELGYVALNH
LEKDERDRVLHSLFHPEGEHKFAICRLPIGASDYALEWYSHNETDGDVEMKHFSIERDHQ
YLIPFIREALQLNPNLKLFASPWSPPTWMKSPKAYNYGTLRWEKDILKAYALYFVRFVQA
YREAGITIHQIHVQNEVIADQKFPSCVWTGEQLREFIRDYLGPAFEEHGLDTEIWLGTIN
APDPWEELIKKTSTGFDEYAHTVLSDPEAYKYIKGVGYQWAGKNAIQRTVASYPELRYMQ
TENECGNGENSWDYAKYVYNLYQHYFSNGVNAYIYWNMVLEPKGKSTWGWEQNSMITVDP
ADRKPVLNPEYYVMKHFSHFVLPGARRIGLRGSWTGNAVAFQNTDGQRVVVIANPFKESR
VLNLSLGETTHRLELEPESFNTIVIPS
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatcaaaccattcagtggttttccacttctaaagctaaagcttggcaatcccaa
gctcatcatcttaccgatacccaagatagtgccaacctaacccttacgggagaaacacat
cagcttgtcgaaggttttggtggctgttttaatgaattgggttatgtagccctgaatcat
ttggaaaaggacgaacgagatcgggtgcttcattctctctttcatccagagggcgagcac
aaatttgcaatatgccgacttcctattggagcgagtgactacgcgctggagtggtacagc
cacaatgaaacagacggcgacgtggagatgaagcacttttccattgagcgtgatcaccaa
tatctcattccttttattcgggaagcgttacaactcaatcctaacctgaagttgttcgct
tcaccctggagcccgccgacatggatgaaatcaccgaaagcctacaattacggcactctg
cgctgggaaaaggatattttgaaagcgtatgcattgtactttgtcagatttgttcaggct
taccgcgaggcaggtattacgatccaccagattcatgttcaaaatgaagtcattgccgat
cagaagttcccttcctgtgtatggaccggagagcaactgcgtgaatttattcgcgactat
ttgggtcctgcttttgaggaacacggactggatacggaaatttggctgggtaccattaac
gcacccgatccgtgggaggaattaataaaaaagacttcgaccggattcgatgagtatgcc
cataccgtattgagtgaccccgaggcctacaaatatattaaaggcgtaggctaccagtgg
gcaggcaaaaatgccattcagcgcaccgttgccagttatcctgagcttcgttacatgcaa
acagaaaatgaatgcggcaacggagaaaactcatgggactacgccaaatatgtatataat
ctgtaccagcactacttcagcaatggtgtgaatgcttatatttactggaatatggttttg
gaaccgaaaggcaagagtacatggggctgggagcaaaattcgatgattactgttgatccc
gcggatcgaaaacctgtcctgaacccggaatattacgttatgaagcatttttctcatttt
gtattaccaggtgcccgacgcatcggacttcgtggctcatggactggaaatgcagttgct
tttcaaaatacagacgggcaaagggtggtggtcatcgccaatccgttcaaggaatcgcgt
gtgctgaatctgtctctcggtgaaacaacacaccgcttggagctggagccggagtccttt
aatactatcgtgattccttcttaa

DBGET integrated database retrieval system