KEGG   Paenibacillus polymyxa CR1: X809_03400Help
Entry
X809_03400        CDS       T02956                                 

Definition
(GenBank) hypothetical protein
  KO
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
ppol  Paenibacillus polymyxa CR1
Brite
Enzymes [BR:ppol01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     X809_03400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(735087..735815)
Genome map
AA seq 242 aa AA seqDB search
MKGEVDPFQKIGNEIGILVVHGFTVTPQSMRPLANAFADEGYTVNLVKLKGHGETPEKLA
ATTKEDWKASVLEGLNWLQQHTKIQFVIGQSMGGALTLFLAQREPLSGILLINPAINIPE
FEKITKEFSPSEYLDGIDSDIKNSNVKEIAYSKIPVSSFQEVINLVKEVRNNVAQITCPV
MIFASVEDHIVPPSNSDWIYSQIRSSEKSLIKLENSFHTASLDNDQKKIINHSIDFISKF
SN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
attaaaggagaagtagatccttttcaaaaaatcgggaacgaaataggaattcttgttgta
catggttttacagtaactccacaaagcatgcgccctttagcaaatgcttttgctgatgaa
ggctatactgttaatcttgtaaaactgaaaggacatggggaaacccctgaaaaattagct
gccactacaaaagaggattggaaagcatccgttttagaaggtttgaactggttacaacaa
cacacaaaaatacagtttgttattggtcaatcaatgggaggtgctttaaccctgtttctc
gcacaaagggagccgctttctggaattcttcttattaatcctgcaattaatatacctgaa
tttgaaaagataaccaaggaattctctccttctgaatatttagatggaattgactcagat
attaaaaacagcaatgtaaaggaaattgcatattcaaaaattccggtttcttcttttcaa
gaggttatcaatttagtaaaagaagttcgtaataatgttgcgcaaataacttgtccagtt
atgatatttgcttctgtcgaggaccacatcgttccccctagtaattcagactggatatac
agtcaaattcgttcatctgaaaaatcattaattaaattggaaaatagttttcataccgct
tcactggataatgatcaaaagaaaataatcaatcatagtatagattttataagtaaattt
tctaattaa

DBGET integrated database retrieval system