KEGG   Paenibacillus polymyxa CR1: X809_14055Help
Entry
X809_14055        CDS       T02956                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
ppol  Paenibacillus polymyxa CR1
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppol00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    X809_14055
   00330 Arginine and proline metabolism
    X809_14055
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    X809_14055
Enzymes [BR:ppol01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     X809_14055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3107775..3108713
Genome map
AA seq 312 aa AA seqDB search
MTSEWQRLQTKLPEWVEQSRHEYIHGKVAAYIPELSKAPADALGVVVMNGVGETVVAGDT
EIQFTMQSISKVFTLILALMDNGEDVVFSKVGMEPTGDRFNSMLKLELVEPGIPFNPLIN
AGAIAVSSLIRGNSPEEKFARVLQFFRLLTHNDTLEYDQDVYDSESATGHLNRSLAYFLM
EKGILRGHVEDVLEVYFRHCAVKLNCTDLARMGLVLAYNGRDPVTGIPLIPRRYVQIAKT
FMTTCGMYDASGEFAIQVGLPAKSGVSGSIMTMVPGRYGIGLVGPSLNRMGNSTAGVHLL
EKMSRDLDWSLF
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgacatcggagtggcagagattacagaccaaactgccggaatgggtagaacaaagccgt
catgagtatattcatggcaaggtagcagcatatattcccgaactgtccaaagcaccagcc
gacgcgcttggtgttgttgtaatgaacggtgtgggtgaaaccgtggtagccggggatacg
gaaatccaatttacgatgcaaagtatttcaaaggtatttacgctcattctggccttgatg
gataatggagaggacgttgtcttctctaaggtgggtatggagcctaccggagaccgtttt
aattccatgctaaagctagaactggtcgagccgggtattccgtttaacccactgattaac
gccggagcgatcgcagtctcctctctgattcgcgggaacagcccagaagagaagtttgcc
cgtgttctccaatttttccgtctgcttacccacaatgacacattggaatatgatcaggat
gtctacgattcagaatctgccacaggccatttgaaccgttcccttgcttattttctaatg
gaaaaaggaattttaagaggtcatgtggaggatgtgcttgaagtttatttcagacattgt
gctgtcaaattgaactgtacagatttagcacgtatgggacttgtactagcttacaacggc
cgtgatccggtgacaggtataccgctgattccccgccgctatgtacagatcgccaaaaca
tttatgacgacatgcggcatgtatgacgcttcaggggaattcgccattcaagtcggacta
cctgccaaaagcggcgtatcaggcagtattatgacgatggtacccggacgatatggcatt
ggactggttggaccttctctgaaccgtatgggcaacagtacagccggtgtacacttgctg
gagaagatgtctcgggatttggactggagcttgttctaa

DBGET integrated database retrieval system