KEGG   Paenibacillus polymyxa CR1: X809_16025Help
Entry
X809_16025        CDS       T02956                                 

Definition
transglutaminase
Orthology
K00686  
protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13]
Organism
ppol  Paenibacillus polymyxa CR1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3513138..3513860
Genome map
AA seq 240 aa AA seqDB search
MQRLQFEMILRSRIVESAEALHRSGVSFATFSTARCNQQFWDLTEKGGFQIKAGVTPAQG
IRDIFLNGHQYAFECATAMVIVLYKGVLDSILESEFNRIFADMLLYDWHYDSDLRLIQQE
GSHKAAPGDILYFNNPDVSSETLEWKGENVVKLKEDLFYGHGIGILPAKGIIDSLNQHRR
PEATVSAYLTDEVIYPDFIYLSQFAAEGNRKNEISLHTLYQQEYSHHIHTVIGRRQYIRG
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgactacagtttgaaatgattttaagatcgcggattgtagagtccgcagaagca
ttacaccgtagtggtgtatcctttgccacgttttctaccgcacgttgcaaccagcaattt
tgggatttaacggaaaaaggtggctttcagatcaaagcaggtgtcacaccggcacagggg
atcagagatatctttttaaacggacatcaatacgcttttgaatgtgcaacagctatggtt
attgtgctgtacaaaggagtgctggattccattttggaaagtgagtttaatcggattttt
gcagatatgctgctgtatgactggcactatgacagcgacctcaggctcatacagcaggaa
ggaagtcataaagcggctcctggcgatattctgtatttcaacaatccggatgtgtcgtct
gaaacattggaatggaaaggagaaaatgtcgttaagctgaaggaagacttgttttatgga
catgggattggcatcttgccggcgaagggtattatcgattccctgaatcaacatcgtcga
ccggaagccacggtatctgcttatttgacggatgaagtgatctatccggacttcatctac
ctatcccagtttgctgccgaaggaaatcgaaaaaatgaaatctcgctgcatactttgtat
caacaggaatacagtcaccatatacatactgtcattgggagaaggcagtatattcgggga
tag

DBGET integrated database retrieval system