KEGG   Paenibacillus polymyxa CR1: X809_18380Help
Entry
X809_18380        CDS       T02956                                 

Definition
NADPH--cytochrome P450 reductase
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
ppol  Paenibacillus polymyxa CR1
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppol00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    X809_18380
  Amino acid metabolism
   00380 Tryptophan metabolism
    X809_18380
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    X809_18380
Enzymes [BR:ppol01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     X809_18380
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     X809_18380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4075088..4078264
Genome map
AA seq 1058 aa AA seqDB search
MTSTDLIPQPKTYGPLGNLPLIDTHAPVQSLVKLSYEYGPIFRMDLPEGTNIYISGHKLV
ADACDESRFDKQVWAPLQKVRAFAGDGLFTSWTEEPNWRKAHQILLPSFSQRAMKGYHNM
MLDLAVQLIQKWSRLNPDESVEVPEDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFVTSMT
RALDEAMGQLQRLNLQNKLMLSKRKQFKHDIETMFSLVDSIIQERKTLGNQGEEDLLARM
LEGKDPETGETLDDENIRYQIITFLIAGHETTSGLLSFAIYYLLKNPRTLTKAYEEVDRV
LTDSLPSYTQVRELKYIRMILNEALRLWPTAPAFSLFAKEDTLLDGTYPLKKGDSVNVLI
PKLHRDTEAWGEDIEEFRPERFEDPSAIPQDAYKPFGNGQRACIGQQFALQEATLVLGMV
LKHFELIDHTHYELKVKETLTLKPEGFTIQVRPRSTQTAVMLPGAVQELHEQEEQKVAPP
HAEKHDTSLLSLYGSNLGTAEGLAGELADLGRNWGFNSSIATLNDRVDNLPKEGVVLITT
ASYNGHPPDNADAFVQWLEQADEGQLAGVRYAVFGCGDRNWASTYQRIPRLIDELMSAKG
AKRLYDRGEGDASGDFEKDWEAWNHGLWPDLLNAFGVEHNDTEPQDSNSLSIEFVSAILS
TPLADNYGAVTAVVTANRELLAAESERSTRHLELKLPTGLSYREGDHLGVLPRNPASLVK
RVMQRFKLQEQDYIVLRGSDRDAAHLPLDRPVSIEDLFTLSVELQEPATRAQLRQLASFT
VCPPHKKEIEALLEDTTFDREIRQKRVTMLDILEKYPASELPFENFIALLPPLKPRYYSI
SSSPLELANSVSITVGVVRGPARSGQGEYLGIASNYLAQLQPDDPIVIFVRKPQSGFRLP
EDPTVPVIMVGPGTGVAPFRGFLQTRHVLKERGEQLGEAHLYYGCRNPKLDYLYKQELQA
WEQEGIVTLHTAFSRLPDQPKRYVQHVMKENVDALIHLLDEGAHLYVCGDGSRMAPDVED
TLCAAYAEAHHTSKEEAQQWLDRLQQEKRYAKDVWTGI
NT seq 3177 nt NT seq  +upstreamnt  +downstreamnt
atgacttcgacagatttaattccacagcccaaaacttatggtcccttaggtaatctgccc
ttgatcgatacacatgcccctgtccagtctttggttaagctttcttatgagtacggtcca
atttttcgcatggatctgcctgaaggaacgaacatttatatttccggtcataagctggtc
gcagatgcttgtgatgaatcccgtttcgacaaacaagtgtgggctccattacaaaaagta
cgagcttttgcaggagacggactattcacaagctggactgaggaaccgaactggcgcaag
gcccaccaaattttgctaccaagcttcagtcagagggctatgaagggttaccacaatatg
atgcttgatcttgctgttcagctgatacagaaatggtctcggcttaatcccgatgaaagt
gtagaggtaccggaagatatgacccggctgactttggataccatcggattatgcggcttt
aattatcgttttaacagcttctaccgcgatcagccccatccgttcgtgaccagcatgaca
cgcgcattagatgaagcgatgggtcagctgcaacgccttaatctgcaaaacaagctgatg
ttatcgaagagaaaacagtttaaacacgacatcgaaacgatgttttcgctggtagacagc
attattcaagaacgcaaaacccttggcaaccaaggagaagaggatttactggcacgtatg
ctggaaggcaaagatccagaaactggtgaaacgctggatgatgaaaatatccgctatcag
atcatcacttttctcatcgccggtcatgaaacgaccagtgggcttttatcctttgctatt
tactatttgcttaagaatccgcgaacgctaaccaaggcctatgaagaagtggatcgcgtg
ctcaccgattcgctgccttcctatactcaggttcgtgaactcaagtacataaggatgata
ctgaatgaagctctgcgactatggccgacagcgcccgcgttctctctctttgccaaagaa
gatacgttgctcgacggaacctacccacttaaaaaaggtgacagcgtcaatgtactcatt
ccaaaactgcaccgtgataccgaggcttggggcgaagatattgaggaatttcgaccggag
cgcttcgaggacccatccgccattccgcaagatgcctacaaaccgtttggcaacggtcaa
cgcgcctgtattggacagcagtttgccttacaggaggccactcttgtgctgggtatggta
ctgaaacattttgagctgattgatcatactcattatgagttgaaagtcaaagaaacgctc
acactcaagccggagggcttcaccattcaagtacgcccgcgcagcacacagactgccgtt
atgctgccaggtgccgttcaagaacttcatgaacaagaggaacaaaaggttgcacccccc
catgccgaaaagcatgatacttctttgctttctttgtacggctcgaatctgggtacagct
gagggacttgcaggtgaactagccgatttaggtcgaaattggggtttcaacagtagcata
gcaactctgaatgatcgtgtggacaatttgcctaaagaaggcgtggtacttattacgacc
gcatcttataatgggcatccgccggacaatgctgatgcctttgtacaatggttggagcag
gcagacgaggggcagctggcaggcgtaagatatgctgtattcggctgcggcgaccgcaat
tgggccagcacgtatcagcgtattccaaggctgatcgacgagctgatgtctgccaaaggg
gcaaagcgactgtatgaccggggtgagggcgatgccagcggtgacttcgagaaggattgg
gaagcctggaaccacggcttatggccggatttgttgaatgctttcggggtagagcacaat
gatacagaaccgcaggacagcaacagcctgagcatagagttcgtcagcgccatactcagt
acacctcttgcagacaactacggagcagttaccgccgtcgttacagcgaatcgtgagctg
cttgctgctgaaagtgaacgtagtacacgacatctggagctcaaattaccaaccggattg
tcctatcgcgaaggtgaccaccttggtgtgttgccgcgtaatcctgcttcgctggtcaaa
agggtgatgcaacgctttaaattacaggaacaggattacatcgtattgagaggcagtgac
cgggatgcggcgcatctccccttagatcggcctgtcagcatagaagatttgttcactctc
agtgtggaactgcaagaaccggcaacgagagcccagctacggcaactggcatcctttaca
gtgtgtccaccgcacaagaaagaaattgaagctttgctggaggatactacctttgatcga
gagatacgacagaagcgcgtcacgatgctggatattctggagaagtatccagccagcgag
ctgccatttgaaaactttattgcgctcttaccgccactcaagccccgctactatagcatc
tccagttcacctcttgaattggcgaattcggtgagtataacagtgggcgtcgtgcgtgga
cccgcccgtagcggacaaggtgaatacctaggaattgcctccaattatttggcacagctc
caaccagatgatcctattgtcatttttgtgcgtaagcctcagtcgggcttccgattgcca
gaagacccgaccgtgcctgtcatcatggtcggtccgggcactggagtggcaccattccgc
ggattcctccagacacgccatgtacttaaggagagaggagaacagctcggcgaggctcat
ctatactatggctgccgtaatcctaagctcgactatctgtacaagcaagagctgcaagcc
tgggagcaagagggaatcgttacgcttcatacagccttttcacgtctgcccgatcaaccc
aaaagatacgtgcagcatgtcatgaaggaaaatgtggacgctctgattcacttgcttgat
gaaggagcgcatctgtatgtatgcggtgatggtagccggatggctcccgatgtagaagac
accctttgtgctgcttacgcggaagcacaccataccagtaaagaagaagcacagcaatgg
ttggatcgtctccaacaggaaaaacgctatgccaaggatgtctggacaggcatctaa

DBGET integrated database retrieval system