KEGG   Paenibacillus polymyxa CR1: X809_26225Help
Entry
X809_26225        CDS       T02956                                 

Definition
alpha-amylase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
ppol  Paenibacillus polymyxa CR1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppol00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    X809_26225
Enzymes [BR:ppol01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     X809_26225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5718205..5719698
Genome map
AA seq 497 aa AA seqDB search
MKRNHTMMQFFEWNVEADGSHWKKLTRLAPELKAKGIDAIWIPPVTKGQSPEDTGYGVYD
LYDLGEFDQKGAVRTKYGTREDLLEAVAACVRHGVAVYVDLVMNHKAGADETEVFKVVEV
NPDNRNEVISEPFDIEGWTKFTFPGRQGQYSTFQWNFEHFNGTDYDASQDRTGIYRILGK
NKSWSENVDDEFGNYDYLMFANIDYNHQDVRKEMIRWGKWLVDTLQCNGFRLDAIKHINH
EFVREFATEMIKKRGQDFYMVGEFWKPDLESCQKFLDTIDYKIDLFDVSLHYKLHSASLG
GKDFDLSTIFEDTLVHTHPLNSVTFVDNHDSQPHEALESWVEDWFKPSAYALILLRKDGY
PCVFYGDYYGIQGQTPVKGKQAELDPLLYARYHKAYGEQKDYFDDPHTIGWVRQGVPELE
GSGCAVVITNANDGEKRMFVGKQHAAEEWIDLTGRHDHTVKIEQDGYGIFPVRAGSVSVW
ALPAEEDSQETEEEANA
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggaaccatacgatgatgcaatttttcgagtggaatgtcgaagctgacggttct
cactggaagaagcttacccgcctggcgccggaactgaaagccaaaggaattgacgcgata
tggattccacctgtcaccaaaggccaatcgcccgaggatacgggatacggcgtctatgac
ctttatgatctgggcgaatttgaccaaaaaggtgcggtgcgcaccaaatacggaaccagg
gaagacctgctggaggctgttgccgcctgcgttcgccacggtgtggccgtctatgtcgat
ctggttatgaaccataaggctggcgcggatgaaaccgaagtgttcaaggtcgtcgaggtc
aatccggataaccgcaatgaggtcatttccgagccctttgatatcgagggctggactaaa
tttacgttccccggccgtcaaggtcagtattccacatttcaatggaactttgaacatttt
aacggaaccgattacgatgcaagccaggaccggacaggaatctatcgtattttaggtaaa
aataaaagctggagcgaaaatgtagatgatgaattcggcaattatgattatttaatgttc
gccaatattgattataatcatcaggatgtgcgcaaagagatgatccgctggggcaaatgg
ctggtagatactctgcaatgcaacggattccgtctggatgcaatcaagcatattaatcat
gaatttgtacgagagtttgctacagaaatgattaaaaaacgcggacaggatttttatatg
gtaggcgagttttggaaaccggatctggaatcgtgtcaaaagttcctggataccattgat
tataaaatcgacctatttgacgtatccctccactacaaactacatagcgcttccttgggt
ggcaaggatttcgatttaagcaccattttcgaggatacgcttgttcatacccatcccctg
aactcggttacttttgtcgataatcatgattcccagccgcatgaagcgcttgaatcctgg
gtggaggactggttcaagcccagcgcctatgcacttatcttgctgcgcaaggacggttat
ccctgcgtattctatggcgattactacggcatccagggacaaacgcccgtcaaaggcaag
caggctgagctagacccgcttctatatgcccgataccataaagcttatggtgagcaaaaa
gattatttcgatgatccccatacgattggatgggttcgtcaaggcgtgcctgagctggaa
ggctccggatgtgctgtggtgatcaccaacgcaaatgacggagaaaagcgcatgttcgta
ggcaaacaacatgcagcggaagaatggatagatttgaccgggcgtcacgatcatactgta
aagattgagcaggatggctacggcatatttcccgttcgtgccggcagtgtatcggtgtgg
gcacttcccgcagaggaagacagccaggaaacagaagaagaagcgaacgcttaa

DBGET integrated database retrieval system