KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_10108Help
Entry
PHYPADRAFT_10108  CDS       T01041                                 

Gene name
HAC1501
Definition
p300/CBP acetyltransferase-related protein
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
ppp  Physcomitrella patens subsp. patens
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1617 aa AA seqDB search
KLPDFVKRLEEALYKNAPSKEEYADLKTLEQRLQSVARRMVPKQQPHSMATNAPMGVMMP
TPGATSNMIPTPGNGNTLMPTASGVSSMMPTPGSTGNMIQPGAGIAGGLNGMMSISGGNN
NVMNAMSHGAGTMMPTPGTSSNMIPTSGHTNMYNISSSNSMSTPGVSGSNYTLDSQQPLG
SARMASNGHTPSSLGVAAGSQMIPTPGLNTSQGLGMAPASSCGLGLPHGGVGVGQLQQHQ
FGVGPGNRMFDGINGQLSGGLASVHLMNGSPNLHSPASFLNTSQYSSLQLQQQQQRMSQQ
QQQQQQQQQQHQHQRSQNLRIQRLPSQQTQQQQQQQQASFQQQVHQRNNLQHQLNNGLAS
RNQQQQLNQLSNNQTQRQQAIQQQQQQQQQLNRLPKPASQQRQVFTMIQQQRQGHAQPSQ
QVMQLQQQQSQQQSQQPQTQQLRGSGASQVSSQSQFVQQQETQHVQSNQTPQQNTFGQGA
SYQRVPVPGQQQQNQAAQARQAGGTNGSTLPSSTMNASGQVGASTMNASGQRQQQYSKQQ
RWLLFLRHASKCTAPEGECQITPHCHMARQLWTHIASCRDRECTFSRCNASRTLLHHHQH
CRDARCPVCGPVRQQVMNQQRGQANPPAAQQGGAAGAASNSTNPGVSSFALSPNGVESCP
TGEAAALEETDVQQPPTKRAKTEPVSGSSLPLPGTSTHTLAPGKPAAPKPSPAQIPARPQ
IMGTKPEQVTVKTEITATSGPASTKVEQQLNGHQTGVFMHSGFTSAKTEVPSQPKSEPRQ
QVSNAAVKAEPHNGGATVPTSAPKVELGAAAAPVSNMATVPTKTGKPKNLGTSLTELFTP
QQIREHITGLRQWVGQSKAKAEKNQALSEYTISENACQLCAVEKLTFDPPPIYCTACGAR
IKRNALYYTTGSGDTKHYFCVPCYNEVRSENVEMEGMIYPKSKLEKRKNDEETEEAWVQC
DKCNLWQHQVCALFNGRRNEGDSEYICPECCCVEMENGERKPLPPSAVLGAKDLPKTFLS
DHLEQRLARKLKQERSERAKVQGKNVDEVASAEALVVRVVSSVDKKLEVKQRFLEIFQEE
DYPTEYPYKSKVVLLFQKIEGVEVCLFGMYVQEFGMECSLPNQRRVYLSYLDSVKYFRPD
VRTVNGEALRTFVYHEILIGYLDYCRRRGFSSCYIWACPPLKGEDYILYCHPEIQKTPKS
DKLRDWYLTMLRKASNDGIVVEITNLYDYFFTSTGECKAKVTAARLPYFDGDYWPGAAED
MIVQLQQEEEDVRKNGLKKGKTKKQPTKRSSKGMAQTELASNASKDSQLMQKLGESIFPM
KEDFIMVHMHHACTHCRLFIVSGCRWVCKQCKNFQLCDKCYDAELKLDERERHPINMKEL
HSFQPFEILDIPSDTKDKDELMESEFFDTRQAFLSLCQGNHYQYDTLRRAKHSSMMVLYH
LHNPTAPAFVVSCNICHQDIEAGNGWRCETCADFDLCNKCKDSAKHPHKLTPFHDRTAQN
KEARQQRVLQLRKMLELLVHASQCGISTCQYPKCRSVKGLFRHGMNCRVRASGGCNMCKR
MWYLLQLHARACKESECRVPRCKDLKEHLRRLQQQMESRRRVAVMEMMRQRAAEAAG
NT seq 4851 nt NT seq  +upstreamnt  +downstreamnt
aagcttcctgattttgtgaagcggctagaggaagcattgtacaagaatgcacctagcaag
gaggaatacgcagatcttaaaacattagagcaacggctgcagtctgtggcacggcgcatg
gtgccaaagcaacaaccgcattcgatggccacaaacgctcccatgggtgtaatgatgcca
acccctggtgcaacgtccaatatgattcctacacctgggaacgggaacaccttgatgccc
actgctagcggcgttagctcaatgatgcccacacctgggagcacagggaacatgatccag
ccaggagctggcatcgcaggaggcttaaatggcatgatgtcaatttcagggggtaacaac
aatgttatgaatgccatgagccatggtgccggaactatgatgccaacaccagggacttct
agcaacatgatacccacctctggacacacgaacatgtataatatatctagcagcaattcg
atgtctactcctggagtttctggttctaattatacgttggattctcagcaacccttgggt
agcgcacgtatggcttcaaatggacacacaccatccagcttgggtgtagcagctggtagt
cagatgatcccaactccgggactcaacacttctcagggattggggatggctccagcatcg
tcatgtggcctagggctcccacatggtggagttggtgtaggacagttacagcagcatcag
tttggagtcgggccaggtaatcgcatgtttgatggcatcaacgggcaactgagtggaggt
ctagcaagtgttcacctaatgaacggatctcctaacctgcactcaccggcttctttttta
aacacgtctcagtactctagtttgcaacttcagcaacaacagcagcggatgtcccaacag
cagcaacagcaacagcaacagcaacagcaacatcaacatcaacggtctcaaaatctacga
attcaacgcttgccatcacagcaaactcagcagcagcagcagcagcagcaagccagtttt
cagcagcaggttcatcaacgcaataatttgcagcatcagctaaataatggcttggcgtcc
aggaatcagcagcaacagcttaaccagctatctaataatcagacacagaggcaacaagca
atacagcagcagcagcagcagcagcagcagctcaatcgtcttcccaaacctgcttcacag
caacggcaagttttcactatgatccagcagcagaggcaggggcatgcacagccgtcacaa
caggttatgcagctacaacagcagcaatcgcaacagcagtctcagcaaccacagacccag
caacttcgaggttctggtgcttctcaggtctcttctcagtctcaatttgtgcagcaacaa
gaaacacagcacgtgcagtctaatcagacacctcagcaaaacacttttggccaaggagcc
tcttaccaacgagtgcctgttcctgggcaacagcaacaaaaccaggcagcacaagctcgt
caggctggaggaacaaatggctctactcttccttcttctaccatgaatgcctctggccaa
gttggagcttctaccatgaatgcctctggccaaaggcagcaacagtactcaaagcagcag
agatggttgttgtttttgcgtcatgctagtaagtgtacagctccagaaggagaatgccag
atcactcctcactgtcacatggcaaggcagctctggactcatatagcatcatgccgagat
cgggagtgcacattcagtagatgcaatgcatctcgcactttgcttcaccatcaccagcat
tgtcgtgatgcacggtgtccagtttgcggacctgtacgccaacaagtcatgaatcaacaa
agagggcaagctaatcctccagctgcgcaacagggaggagcagcaggagctgcatccaac
tcgactaatccaggtgtgtcatcatttgctttatcccccaatggggtagagtcttgtcct
accggcgaggctgctgctttggaggaaacggatgtacaacagccacccacgaagcgtgcc
aaaacggaacctgttagtggcagcagtttgcctttgccaggaacttctacacatacctta
gcacccggtaagccagcagcacctaaaccaagtcctgcacaaataccagcacgcccccaa
atcatggggacaaaacctgagcaagttacagtgaagacagagattacggccacctcagga
cctgcttcaaccaaagttgagcagcagttaaatgggcaccagacaggtgtgtttatgcat
agtggttttaccagtgctaaaacagaggtacctagccaacctaagtcagagccccgacag
caggtgtcgaatgcagcagtcaaagctgaacctcataatggaggtgccactgtacctact
tctgctcctaaggttgagttaggtgcggctgccgcgccagtgagcaatatggcaacagtc
ccaacgaagactggaaaacctaagaacttaggcacatcattaactgagctcttcacacct
cagcagattcgtgagcacattacagggttgcgccaatgggttggccagagcaaggccaag
gctgagaaaaatcaggccttgagtgagtatacaattagtgaaaacgcatgccaactatgt
gccgtggagaagttgacgtttgatccccctccaatctactgcactgcatgtggggcccgt
ataaagaggaacgctctatattacactactggctcaggagacactaagcactacttttgt
gtgccttgttacaatgaagttcgatcagagaatgtggaaatggagggaatgatttatcca
aaatcaaagttggagaagcgaaagaatgacgaagaaacagaggaggcgtgggtacaatgc
gataaatgcaacttgtggcagcaccaagtttgtgctttattcaacggtcgccgaaatgaa
ggagacagtgaatacatttgtccagagtgttgttgtgtggaaatggaaaacggtgaacgt
aagccactgcccccatctgcagtcttaggtgctaaggacttgccaaaaaccttcttaagt
gatcatttggagcaaagattggcacgtaaactcaaacaagagcgttcagagcgggccaaa
gttcaagggaagaacgtggatgaggttgccagtgcagaggccttagtggtcagagttgtg
tcctctgtggacaagaagctggaagtcaagcaacggtttttggaaatttttcaagaagaa
gactatccaactgaatatccatacaagtcgaaggtggtattgctgtttcaaaagatcgaa
ggtgtagaagtttgtctcttcggcatgtatgtccaagagtttgggatggaatgctctctt
ccaaatcagcgaagggtgtacttgtcatatttggattctgtgaaatactttcgcccagat
gtgcggactgtcaatggagaggctctgcgcacttttgtttaccatgaaattctgattggc
tatttagactattgtcggaggagaggttttagtagttgttacatttgggcttgcccacca
ttaaagggtgaggattatattttatattgtcatccggaaatccaaaagacacccaaatcc
gacaagcttcgagattggtacttgacgatgctgcgaaaggcaagcaatgatgggattgtt
gttgagatcactaatttgtatgactacttttttacctcaactggcgaatgcaaagctaag
gtgacagcagctcgcttgccatattttgatggtgactactggccaggcgcagccgaggac
atgatagtgcaattgcagcaggaagaggaggacgttcgcaagaatggtttgaagaagggc
aagactaaaaagcagccaactaaacgttcttctaaaggaatggcccaaaccgagctggct
agcaatgccagcaaagatagccaacttatgcagaagttgggagaatcaatcttcccaatg
aaggaggactttataatggtgcatatgcatcatgcatgcacgcactgccgtctcttcatt
gttagcggttgtcgctgggtttgcaagcaatgtaaaaactttcagctttgtgataaatgc
tatgatgcagaactaaagcttgacgagagggagaggcatcccattaatatgaaagaactg
cattcttttcagccgtttgaaatccttgatattccaagtgacacaaaggataaggatgaa
ctcatggaaagcgagttctttgacactcgacaagcgttcctaagtttgtgtcaagggaat
cactaccaatacgacactttgcgacgcgcaaaacattcttccatgatggtgctttaccat
ttgcacaatccaacagctccggcatttgtggtgagctgtaatatttgtcatcaggatatt
gaggcgggtaatggctggcggtgtgaaacttgtgccgactttgacctttgtaacaagtgc
aaggattcggcgaaacacccgcataaacttactccgttccatgatcgaactgcccagaac
aaggaagctcgacaacagagagttcttcagttgcggaaaatgctcgaattactggtacac
gcatcccagtgtggaataagtacctgccaataccccaaatgtcgtagtgtgaaaggcctg
tttcggcatggcatgaactgcagagttagagcctctgggggttgtaatatgtgcaagaga
atgtggtaccttttgcagcttcatgctagagcttgcaaggaatccgagtgcagggtacct
cgttgcaaggatttgaaagagcatttgcgccgactacagcaacagatggaatcacgacga
agggttgcggtaatggaaatgatgcggcaaagggcagctgaagctgcaggc

DBGET integrated database retrieval system