KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_105048Help
Entry
PHYPADRAFT_105048 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PHYPADRAFT_105048
Enzymes [BR:ppp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     PHYPADRAFT_105048
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 309 aa AA seqDB search
MVEFVKDGATGMEKVLLREPGGATAQIHLYGGHVTSWKNEKGEEMLFLSSKAIFRPPKAI
RGGIPVCFPQFGGFGALEQHGFARNRMWTVDPNPPPPPPFAGTGPNKPYIDLVLKPADDE
LKIWPHNFELYQRVMLGFHGELTSIIRVRNTDNKPFTFTFALHTYLSVSDISEVRIEGLE
TLDFLDNLRDKERLTEQGDAITFDSEVDRIYMGTPTKIAVIDHEKKRTFVLKKEGLPDAV
VWNPWEKKAKAMADFGDDEYKHMLCLEAAAVEKPITLKPGEEWKARQEISAVPSSYFSGQ
LDPCKVLNG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtagagtttgtcaaggatggagccacgggcatggagaaagtcctgctgcgtgagccc
gggggtgcaaccgcacaaattcatctttacggagggcacgtgacgtcatggaaaaatgag
aaaggggaggagatgcttttcttgagctccaaggctatatttagacctccaaaggcaatt
cgcggtggtatcccagtttgttttcctcagtttggtggatttggtgctctggaacagcat
ggatttgccagaaatcggatgtggactgttgacccgaatccgcctcctccacctcctttc
gcaggcactggccccaacaagccctatattgatctagttctgaagccggcggacgatgag
ttaaagatctggcctcacaacttcgagctctaccagagagtgatgctggggttccacggt
gagctcacctcaattattcgagttcgaaatacggataacaagcctttcactttcaccttc
gcgctgcacacatacctgtccgtctcagacatcagcgaggtccgtatagaggggctcgag
acgttagatttcctcgataatttgcgggataaggaaagattaacagaacagggagatgcg
atcacttttgattctgaagtagatcgcatttacatggggactcctacgaagatagccgtt
atagaccatgagaagaaacggacttttgtacttaagaaggagggtcttccagatgcagtg
gtgtggaatccctgggagaagaaagccaaagctatggcagactttggtgacgatgagtac
aagcacatgttgtgtttagaggcagcggctgtggagaagccgatcacattgaaaccaggg
gaggaatggaaagctcgtcaagaaatttcggctgtgccatcgagttacttcagtggccaa
ctagatccgtgtaaggtccttaacgggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system