KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_105202Help
Entry
PHYPADRAFT_105202 CDS       T01041                                 

Definition
(RefSeq) hypothetical protein
  KO
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    PHYPADRAFT_105202
Enzymes [BR:ppp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     PHYPADRAFT_105202
Protein kinases [BR:ppp01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   PHYPADRAFT_105202
Chromosome [BR:ppp03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     PHYPADRAFT_105202
Exosome [BR:ppp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PHYPADRAFT_105202
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 401 aa AA seqDB search
MDCESREESAGEASCQTVDAEDQVLDDSRPDTECESRIESVPNTLQGMKYTQYNVRGDKF
EVYDKYVMIGPIGHGAYGDVCAFTNRETGEKVAIKKIGNAFQNNTTARRTLREILLLRHT
EHDNIIPIRDIIVPANIEDFHDAYIANELMDTDLHQIVRSTKLDEYHCQFLLYQLLRGLK
YIHSANILHRDLKPSNLLINCNDCLLKICDFGLARTSAEDDFLTEYVVTRPYRAPELLLG
SRMYTAAVDMWSVGCIFMEMLTGQPLFPIRSRQEHPVNHLKLITELLGTPDASDLSFLQN
PDARQRIQMALLGQERKPLFSRFPQTSAIACDLAEKMLRFNPSNRITAEEALAHPYLAAL
HDLSDEPTCHLMFDFDAYLPSLTVEHVKTLIWREATLINVQ
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggattgtgaatcacgtgaagagagcgctggagaagcaagctgccagacagttgacgca
gaggatcaggttttggatgactcacgtcctgatacagaatgtgagtcacggatcgagagc
gtgccaaacaccctacaaggaatgaagtacacacagtacaatgtgaggggcgacaagttt
gaagtctacgacaagtatgtaatgattggtcccattggtcatggagcttatggcgatgtg
tgtgctttcacgaacagggagacaggggagaaagtggccataaagaagattggaaacgca
tttcagaacaatactacagcgaggcgcacacttagagagattttgttgctccgccatact
gaacacgacaacatcattcccatcagagatatcattgtgcctgctaacattgaggacttt
catgatgcctatatcgcaaatgagctcatggatacagaccttcaccagatagtgaggtca
acaaaacttgacgaataccattgccagttcctgctttaccagctgttgaggggtctcaaa
tacatccactctgccaatatattgcaccgtgacctgaagcccagtaatctcctcatcaat
tgcaacgactgtctactcaagatttgtgattttggcttggctcgaacatctgcagaggat
gacttccttacggagtatgttgttactcgaccatatcgagctccagagctcttgcttggg
agccgaatgtacacagcggctgttgatatgtggtcagtgggctgcatcttcatggagatg
cttacaggacaacctttgtttccaatccggtcaaggcaagagcatcccgtgaatcatttg
aaactcatcacggagcttctaggaacacccgatgcttcggacctgtcgtttctgcagaat
ccagatgctcggcaaagaatccaaatggctttgttaggtcaggaaaggaagcctttgttt
tcgaggtttcctcaaacgtctgcaatagcttgtgacttagcggagaagatgctgaggttt
aacccatccaacagaataactgcggaagaggccttggcccatccttacttggcagcgctt
cacgacctaagtgatgagccaacgtgtcatcttatgttcgacttcgatgcttaccttccc
agcctaacagttgagcatgtgaaaactcttatctggagggaagctacacttatcaacgtc
cagtaa

DBGET integrated database retrieval system