KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_107034Help
Entry
PHYPADRAFT_107034 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K01177  
beta-amylase [EC:3.2.1.2]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PHYPADRAFT_107034
Enzymes [BR:ppp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.2  beta-amylase
     PHYPADRAFT_107034
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 552 aa AA seqDB search
MSGLQLLTVGLVPAKSSEFVGCTKFSQCSNLRLPESRSVQWGVFSHSWTHFSPAAISTSG
QLREGSKRGRGVWCRAVEVEKLPEVDGTSTLKDLEIEEVTEDLQPTVERDFTGTPNIPIY
VMLPLGTIGHDNKVTNPDDLRQKFNALKTAEVDGVMVDCWWGLVEGKEPQHYDWSGYRQL
FTMVRDCGLKLQVVMSFHQCGGNVGDDVYIPIPQWVLDIGKDNPDIFFTDKSGVVNPECL
TWGVDKVRVLRGRTALEVYYDYMRSFRQEMDEFFMDKTITEIEIGLGACGELRYPSYPET
RGWKYPGIGEFQCYDKYLLEDLRKAAEARGHSHWTKPPSNAGEYNSRPQDTEFFRDGGDY
DSYYGRFFLKWYSDVLIQHGDRVLTFANIAFEGVKIAAKVSGIHWWYKTASHAAELAAGF
YNPANRDGYAAIAQMLAKHGASFNFTCVELRTLAQAKGYPEALADPEGLVWQVLNAAWDA
GISVASENALGCFDRQGYNKILENAKPEKDPDGRHLVAFTYLRLSDELMKEHNFKEFSRF
VKRLHGKPVESD
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgtccgggttacaattgctaaccgttggccttgtgcccgccaaatcgtctgaatttgtt
ggttgcacgaagttcagccaatgcagtaatctcaggctgccggaatcacggtcggtgcaa
tggggcgttttttcccattcgtggacccattttagtccagcagcgatttctacttcggga
cagttacgcgagggttctaagcggggtcggggggtttggtgtcgggctgtcgaggttgag
aagcttccggaggtcgatgggacttctaccttgaaagatctcgagatcgaagaagtgact
gaggatctgcagcctactgttgagcgagattttacagggacaccaaatatccctatctat
gttatgctaccactgggcacaatcggtcacgataacaaagtaacgaatccagacgattta
agacaaaagttcaatgcgttgaagacagctgaagtggatggagttatggtagattgttgg
tggggtttggtggaaggcaaagaaccccagcattatgactggtctggatataggcagcta
tttactatggttcgcgactgcggccttaaattacaggtggttatgtcgttccatcaatgt
ggtggtaacgtaggcgatgacgtttacatccctattcctcagtgggttctagacattggc
aaagacaatcctgacattttcttcacagacaagagcggtgtggttaacccagagtgtctt
acttggggtgtggataaagttcgagttctgcggggtcgaacagctcttgaggtttattat
gattacatgagaagctttcggcaagaaatggacgaattcttcatggacaaaactataact
gaaatagaaattgggttaggtgcttgtggtgagcttcgatacccctcctaccctgaaacg
cgtgggtggaagtatcccgggataggtgaattccagtgttacgacaagtaccttttggag
gatttgcgaaaagcagctgaagcacgagggcactctcattggaccaaacctcctagcaat
gcaggggagtacaattctcgaccacaagacactgagtttttcagagacggaggagactac
gacagctactacggacgcttcttcctgaaatggtactcagatgtcctaattcaacacggg
gaccgagtcttaacatttgcaaacatcgccttcgagggtgtgaaaattgccgcgaaggtg
tctggaattcattggtggtataaaacagctagccatgcggcggagcttgcagctggattc
tacaatcctgccaaccgcgatggttatgcagcaattgcacaaatgttggctaagcatggc
gcttcgttcaatttcacttgcgttgagcttcgtaccctagcacaagcaaaaggctaccct
gaagctttggctgatcccgaagggcttgtttggcaggtcctgaatgcggcctgggacgcg
ggcatctcggttgctagtgagaatgcacttggctgctttgaccgacaaggatacaacaaa
attctggagaatgctaaacctgagaaagaccctgatggccgacacttggttgccttcacc
tacttgagactgagtgacgagctcatgaaagaacacaatttcaaagagttttctcgattt
gtcaagcgtttgcatggtaagccagtcgaaagtgactaa

DBGET integrated database retrieval system