KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_108003Help
Entry
PHYPADRAFT_108003 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K14272  
glutamate--glyoxylate aminotransferase [EC:2.6.1.4 2.6.1.2 2.6.1.44 2.6.1.-]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Alanine, aspartate and glutamate metabolism
Glycine, serine and threonine metabolism
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
C4-dicarboxylic acid cycle, NAD - malic enzyme type
Photorespiration
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PHYPADRAFT_108003
   01210 2-Oxocarboxylic acid metabolism
    PHYPADRAFT_108003
   01230 Biosynthesis of amino acids
    PHYPADRAFT_108003
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PHYPADRAFT_108003
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PHYPADRAFT_108003
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PHYPADRAFT_108003
   00260 Glycine, serine and threonine metabolism
    PHYPADRAFT_108003
Enzymes [BR:ppp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     PHYPADRAFT_108003
    2.6.1.4  glycine transaminase
     PHYPADRAFT_108003
    2.6.1.44  alanine---glyoxylate transaminase
     PHYPADRAFT_108003
    2.6.1.-  
     PHYPADRAFT_108003
Amino acid related enzymes [BR:ppp01007]
 Aminotransferase (transaminase)
  Class I
   PHYPADRAFT_108003
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 480 aa AA seqDB search
MASGKVMDPDNLNENVKKTVYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFP
RQVMALCQAPFLMDDPHVGLLFPADAIAKAKHYLAMTSGGVGAYSDSRGLPGVRQEVANF
ILQRDGYPSDPENIFLTDGASKGVAQVLNALIRDEKDGVLVPIPQYPLYSATIQLLGGTL
VPYYLAEEDNWGLNTNDLRKSVTEARRKGICVRGLVFINPGNPTGQCLTEKNLRELIEFC
IKEKIVLMADEVYQQNVYQDERPFISARKVLMGMGPPVSEALELVSFHTVSKGFLGECGQ
RGGYFEMTNIHPKTVDELYKVSSIALSPNVTGQIMMGLMVSPPKPGDISYPLYKAESEAI
SLSLRKRAHIMTDGFNACENIVCNFTEGAMYSFPQVKLPQAAIAAAKKAGKAPDVFYCLR
LLEATGISTVPGSGFGQKEGTFHVRTTILPSERDMPGIMESFKKFNADFMAQHSDTKSKL
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcggggaaggtgatggacccggacaatttgaacgagaatgtgaagaagacggtg
tatgccgtgcggggagagctctacctgcgcgcctcggagctgcagaaagagggcaagaag
atcattttcaccaatgtcggcaacccgcatgctcttggtcagaagcctcttacattccct
cgccaggtcatggctctgtgtcaggcccccttcttgatggatgacccccatgttgggcta
cttttccccgccgacgcgattgccaaagccaagcactatttggctatgacctcaggaggc
gttggagcttacagtgattccagagggctccctggtgtgcggcaggaggttgcaaatttt
atcctgcagcgtgacggatatccgagcgatccggagaatatcttcctcactgatggagct
agcaaaggtgtagcacaagttttgaatgccctcatccgcgatgagaaggatggggtactg
gttcctattccacaatatcctttgtactcagcaacgattcagcttctaggaggcacactg
gtgccgtattatttggctgaggaggataactggggtttgaatactaatgacctgcgtaaa
tctgtcactgaagctcgcaggaaggggatttgtgtccgaggattggtttttatcaatcca
ggaaatccaactggtcaatgtctaaccgagaaaaatttgcgggaacttatcgagttctgc
atcaaggaaaagattgtgctgatggctgacgaggtttaccagcaaaacgtttatcaagat
gagcgcccctttatcagcgcgaggaaggtgctgatgggcatgggacccccagtcagtgaa
gctctggagttggtttcattccacacggtgtcgaagggtttcctcggagagtgtggacag
cgaggtggatactttgaaatgaccaatattcaccccaagactgtggacgagctctacaag
gtttcctccattgccctgagtcctaatgtcactggacaaatcatgatgggtttgatggtc
agtcctccaaaaccaggagacatttcgtatcctctgtacaaggcagaaagtgaagctatc
tcgctgtctttgaggaaaagagcgcatatcatgacagatggtttcaatgcttgtgaaaac
attgtctgcaattttacggagggagccatgtactctttcccacaagtaaagttgccccag
gctgctattgctgctgctaagaaagcagggaaagctcctgacgtcttctattgcttgcgg
cttttggaagctactggaatttctactgttccaggttcaggatttggccagaaagagggg
acctttcacgtgcggacaacaattttaccctcggagagagacatgcctggaatcatggaa
agcttcaagaagtttaacgcggacttcatggcacaacattcagacaccaagtcgaagctt
tga

DBGET integrated database retrieval system