KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_111033Help
Entry
PHYPADRAFT_111033 CDS       T01041                                 

Gene name
HAM1502
Definition
(RefSeq) histone acetyltransferase
  KO
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
ppp  Physcomitrella patens subsp. patens
Brite
Enzymes [BR:ppp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PHYPADRAFT_111033 (HAM1502)
Chromosome [BR:ppp03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    PHYPADRAFT_111033 (HAM1502)
   HAT complexes
    NSL complex
     PHYPADRAFT_111033 (HAM1502)
    MSL complex
     PHYPADRAFT_111033 (HAM1502)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 296 aa AA seqDB search
MDELAPLDQSLEKEHEEKTKVKNIQVVELGKYEIDTWYYSPYPEEYAHEHKLYICEFCLK
YMKKKKSVERHKIKCELKQPPGDDIYKMTAPFQEKLANAEGTLSMFEVDGRKSKMYLQNL
CLLAKLFLDHKTLYYDVDSFLFYILTENDAFGSHLVGYFSKEKYSAEDYNLACILTLPPF
QRKGYGRFLISFAYELSKKEGKVGTPERPLSDLGQVSFRSYWTRVLLEILRDHHNVSIKD
LTAMTSIRYEDVVTTLQTLNLIKYWKGQYIISVTAKHIDEHLKVFYCLLCLRTSWI
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggacgagttggcaccacttgatcaatctttagagaaagaacatgaggagaagacaaaa
gtaaaaaatatccaggtagtggagttgggcaagtatgagattgatacctggtattattcg
ccctatcctgaagaatacgctcacgaacacaagctttacatctgtgagttctgtctgaaa
tacatgaagaagaaaaagagtgttgaaaggcacaagataaaatgcgagctgaaacaacct
ccaggagatgatatttataaaatgactgcacccttccaggagaaactcgcaaatgctgag
gggactctctctatgtttgaagtcgatggaagaaagagcaagatgtatttgcagaatttg
tgtctgctggccaagctatttctagaccataaaacactatattacgatgtggattcattc
ctattctatatattgacggagaacgatgcatttggaagtcatctggttggttatttttcc
aaggaaaaatactctgcagaagattataatttagcatgcatattgactttacctcctttt
caacgtaaagggtacgggcgttttctaatttctttcgcttacgaattatctaaaaaagaa
ggcaaagttggaactccagagcgtccactgtcagatcttggccaggtgagttttaggagt
tattggactcgtgtactattagaaattctccgtgatcaccacaatgtctccattaaggac
ctcactgctatgacttccatacgatatgaagacgtcgtcaccaccttgcagactttgaac
ttgatcaagtactggaaaggacaatatattatttctgtcactgctaagcatatcgatgaa
caccttaaggtattttattgtctgttatgtcttcgaacttcctggatttga

DBGET integrated database retrieval system