KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_111374Help
Entry
PHYPADRAFT_111374 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ppp01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ppp00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:ppp00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 389 aa AA seqDB search
MSSNLLLSGAPNEIVVPFMGDSVPDGNLASVLKNVGDSVVVDEIVAQIETDKVTIDVRSS
VAGRIEQILARQGDTVTPGTKVAIVAIGEPRAASPPGPTAFTTPSPRAPAAASPAVTVAP
PPPKPGPVKVDAAAAASPKADDLSSPKRAAIPQLQGGERRVLVPMTRLRKRVATRLKDSQ
NTFALLTTFNELDMGNLMELRSQHKDTFLEKHGVKLGFMSGFVKAAVSALKQFPAVNAVI
DGDDIIYRDYIDISIAVGTKKGLVVPVLRGVDGMNFAQIEKMINMLGKKANDGSITIDDM
AGGTFTISNGGVYGSLISTPIINPPQSAILGMHSIVKRPMVVGKDIIARPMMYVALTYDH
RLIDGREAVLFLRAVKDNVEDPRRLLLDI
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcgaatttgttactttcaggtgcccccaacgaaatcgttgttccgttcatggga
gattcagtgccagatggcaaccttgcttcagtattgaagaatgtcggggattccgtggtg
gttgatgagattgttgcccagattgagaccgataaggttacaatcgatgtgcgaagctca
gtcgctggaagaatcgaacagattttagccagacaaggagacacagttactcctggaacg
aaagttgcaattgtggccataggagaacctagggctgcgtctcctcctggtcctacagca
tttaccactccatctccgagagcaccagcagcagcatctcctgcagtaacagtagctcct
ccgccaccaaaaccaggaccagtaaaggttgatgctgctgctgctgcttcgcccaaagct
gatgacctttcatcacctaaacgtgcagcaatacctcagcttcagggcggagagcgaagg
gtactagttccaatgactaggttacgaaaacgagtggctactcgattgaaggattctcaa
aacacttttgcgctcctcacaactttcaacgagcttgatatgggtaacctgatggagttg
cgttctcaacataaggacacgtttctggaaaagcatggtgtgaaactaggatttatgtct
gggtttgtgaaggcagctgtgagtgcacttaagcaatttcctgcagtaaatgcggtaatc
gatggagatgatatcatatacagagactacattgacatcagcattgctgttggaactaaa
aagggacttgtggtgcctgttcttcgaggggtcgatggcatgaactttgcacagatagag
aaaatgataaacatgttagggaagaaggctaatgatgggagcataaccattgatgatatg
gcgggaggaacttttactatctctaatggtggtgtttatgggagtctcataagcactcct
attatcaaccctcctcaatccgcaattctgggaatgcactctattgtgaagcgcccaatg
gttgttggaaaggacattattgctagacctatgatgtatgtggcactcacgtatgatcac
aggcttatagatgggcgagaagctgtcttatttctccgtgcggtgaaagataatgtggaa
gatccgagacgtctacttctagatatttaa

DBGET integrated database retrieval system