KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_112098Help
Entry
PHYPADRAFT_112098 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PHYPADRAFT_112098
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PHYPADRAFT_112098
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PHYPADRAFT_112098
Enzymes [BR:ppp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PHYPADRAFT_112098
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 470 aa AA seqDB search
MAALAPTQATGCTASFQVVRKPSALKDARLTQINALSSSSINGAAGVFARDATAKDVHTR
DQDDIRTYKGHERPDSFGRYGIYGGKYVPETLMDALSNLEVAYRATIKDPEFQKELNDVL
KDYVGRETPLYFAERLTEHYKRDGKGPLIYLKREDLNHTGAHKINNAIAQALLAKRIGKK
RIIAETGAGQHGVATATVCARFGLECIVYMGAQDMERQALNVFRMRLLGAEVRPVNSGTA
TLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMIVRDFHAMIGTEVRRQAMEKWGGKP
DVLVACVGGGSNAMGLFHEFIEDEDIRLIGVEAAGFGTNTSKHAATLTMGEVGVLHGAMS
YLLQDGDGQIIEPHSISAGLDYPGVGPEHSFLKDVGRAEYFSVTDDEALEAFQRLSKLEG
IIPALETSHALAFLETLCPTLEDGTRVVLNCSGRGDKDVNSVIGYLKGKY
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggcggcattagctccaacccaagctactggctgtactgcttcatttcaagtggtgcgc
aagccatcagcattgaaggatgcaagacttacacagattaatgccctatcgtcttcttct
ataaacggggccgctggcgtgtttgcacgcgatgcaactgcgaaggatgtgcacactagg
gatcaagatgatatccgaacgtacaaaggccacgagcgccccgactccttcggaagatac
ggaatttatggaggaaagtatgttcctgagactcttatggatgctcttagtaatctggag
gttgcatatcgtgcgacaatcaaggatcccgaattccagaaggagctcaatgacgtactt
aaggattacgtgggtagggaaacacctctgtacttcgctgaacgtctgacagagcactac
aaacgtgacgggaaaggacctctgatttatctgaagagagaggatcttaaccacactggc
gctcataagatcaacaatgcaattgcccaagccctgttggcaaagcggatcgggaagaag
cgcattattgccgagacaggagcaggccagcacggtgttgccaccgccacagtgtgtgct
cgctttggactggagtgcattgtatatatgggcgctcaggatatggagaggcaagccctc
aacgtattccgaatgcgtcttcttggagctgaggttcgtcctgttaattctggcaccgcc
actttgaaggatgccacttcagaggctattcgcgattgggttacgaatgtggaaactact
cactacattcttggctcagttgccggaccgcacccttaccctatgattgtgcgagacttt
catgcaatgattggaacagaggttcgtcgccaggcaatggaaaagtggggtggtaagccc
gatgttcttgtagcgtgtgtgggaggaggctccaatgccatggggttgttccatgaattt
attgaagatgaggacatccgtctcattggtgtcgaagcagctggctttggtaccaataca
agcaagcatgctgcaaccctgaccatgggagaagtcggtgtcttacatggtgcaatgagt
tatttgctccaggatggtgatggccagattatcgagccacattctattagtgcggggttg
gattacccaggtgttggtcccgaacacagtttcctgaaggatgttggtcgagcagaatac
ttcagcgtgactgacgatgaagccctcgaggcattccagaggttgtccaagttggagggc
atcattccggcactggagacatcccacgcgctggcctttttggagacgctttgccccaca
cttgaggatggcacccgagtggtcctcaattgcagtggccgtggtgacaaggatgtcaac
agcgtgatcggttacctgaaaggaaaatattga

DBGET integrated database retrieval system