KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_112098Help
Entry
PHYPADRAFT_112098 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ppp01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ppp00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ppp00400]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 470 aa AA seqDB search
MAALAPTQATGCTASFQVVRKPSALKDARLTQINALSSSSINGAAGVFARDATAKDVHTR
DQDDIRTYKGHERPDSFGRYGIYGGKYVPETLMDALSNLEVAYRATIKDPEFQKELNDVL
KDYVGRETPLYFAERLTEHYKRDGKGPLIYLKREDLNHTGAHKINNAIAQALLAKRIGKK
RIIAETGAGQHGVATATVCARFGLECIVYMGAQDMERQALNVFRMRLLGAEVRPVNSGTA
TLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMIVRDFHAMIGTEVRRQAMEKWGGKP
DVLVACVGGGSNAMGLFHEFIEDEDIRLIGVEAAGFGTNTSKHAATLTMGEVGVLHGAMS
YLLQDGDGQIIEPHSISAGLDYPGVGPEHSFLKDVGRAEYFSVTDDEALEAFQRLSKLEG
IIPALETSHALAFLETLCPTLEDGTRVVLNCSGRGDKDVNSVIGYLKGKY
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggcggcattagctccaacccaagctactggctgtactgcttcatttcaagtggtgcgc
aagccatcagcattgaaggatgcaagacttacacagattaatgccctatcgtcttcttct
ataaacggggccgctggcgtgtttgcacgcgatgcaactgcgaaggatgtgcacactagg
gatcaagatgatatccgaacgtacaaaggccacgagcgccccgactccttcggaagatac
ggaatttatggaggaaagtatgttcctgagactcttatggatgctcttagtaatctggag
gttgcatatcgtgcgacaatcaaggatcccgaattccagaaggagctcaatgacgtactt
aaggattacgtgggtagggaaacacctctgtacttcgctgaacgtctgacagagcactac
aaacgtgacgggaaaggacctctgatttatctgaagagagaggatcttaaccacactggc
gctcataagatcaacaatgcaattgcccaagccctgttggcaaagcggatcgggaagaag
cgcattattgccgagacaggagcaggccagcacggtgttgccaccgccacagtgtgtgct
cgctttggactggagtgcattgtatatatgggcgctcaggatatggagaggcaagccctc
aacgtattccgaatgcgtcttcttggagctgaggttcgtcctgttaattctggcaccgcc
actttgaaggatgccacttcagaggctattcgcgattgggttacgaatgtggaaactact
cactacattcttggctcagttgccggaccgcacccttaccctatgattgtgcgagacttt
catgcaatgattggaacagaggttcgtcgccaggcaatggaaaagtggggtggtaagccc
gatgttcttgtagcgtgtgtgggaggaggctccaatgccatggggttgttccatgaattt
attgaagatgaggacatccgtctcattggtgtcgaagcagctggctttggtaccaataca
agcaagcatgctgcaaccctgaccatgggagaagtcggtgtcttacatggtgcaatgagt
tatttgctccaggatggtgatggccagattatcgagccacattctattagtgcggggttg
gattacccaggtgttggtcccgaacacagtttcctgaaggatgttggtcgagcagaatac
ttcagcgtgactgacgatgaagccctcgaggcattccagaggttgtccaagttggagggc
atcattccggcactggagacatcccacgcgctggcctttttggagacgctttgccccaca
cttgaggatggcacccgagtggtcctcaattgcagtggccgtggtgacaaggatgtcaac
agcgtgatcggttacctgaaaggaaaatattga

DBGET integrated database retrieval system