KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_112115Help
Entry
PHYPADRAFT_112115 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PHYPADRAFT_112115
   01230 Biosynthesis of amino acids
    PHYPADRAFT_112115
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PHYPADRAFT_112115
   00051 Fructose and mannose metabolism
    PHYPADRAFT_112115
   00562 Inositol phosphate metabolism
    PHYPADRAFT_112115
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PHYPADRAFT_112115
Enzymes [BR:ppp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PHYPADRAFT_112115
Exosome [BR:ppp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PHYPADRAFT_112115
  Exosomal proteins of bladder cancer cells
   PHYPADRAFT_112115
  Exosomal proteins of melanoma cells
   PHYPADRAFT_112115
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 254 aa AA seqDB search
MCSRKFFVGGNWKCNGTVDEVKKICCMLNNGEVPCPNHIETIISPPFVFIPLVKSMLRTD
FQVAAQNCWKGKGGAFTGEISAEMLANLHVPWVILGHSERRQLCGETDAIVAEKTAYALD
NGLKVCLCVGETLEERERNETGAVVARQTAAVASKICCWANVVIAYEPIWAIGTGKVATP
QQAQEVHYNLRKWLDCYVSPHVAMNMRIIYGGSVTAANCKEIGANPDVDGFLVGGASLKV
RRNARLGTKIHDLT
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcgcggaagtttttcgttggtggcaactggaaatgcaatggaaccgttgatgag
gtgaagaaaatatgctgtatgctaaacaatggagaagttccttgtccaaatcatatcgag
acgatcatttcgcctccgttcgtattcattcccttagtgaagagtatgctccggacggat
tttcaggtagctgcccaaaactgttggaaaggcaagggaggagctttcactggcgaaatc
agtgcggagatgctggcaaacttgcacgtgccatgggtcatcctgggtcactctgaaaga
agacaattgtgtggagaaactgatgcgatagtggcagaaaaaacagcatatgcattggat
aatggattgaaggtttgcctttgcgttggtgaaactctagaagaacgagagaggaatgag
acgggtgctgttgttgccaggcaaacagcagcagttgcatcaaagatttgttgctgggca
aacgtggtaatagcatatgaacctatttgggctatcggaactggcaaagtggctactcct
cagcaagcacaagaggttcactacaaccttcgaaagtggctagactgctatgtaagccct
catgtagctatgaacatgcgaataatttacggaggctcagtaacagctgcaaactgtaag
gagatcggggccaatccggatgtggatggttttcttgtgggaggcgcatctttaaaggtt
agacgaaatgcacgtcttggaactaagatacatgatttgacgtga

DBGET integrated database retrieval system