KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_115301Help
Entry
PHYPADRAFT_115301 CDS       T01041                                 

Definition
(RefSeq) hypothetical protein
  KO
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PHYPADRAFT_115301
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PHYPADRAFT_115301
   00640 Propanoate metabolism
    PHYPADRAFT_115301
  Lipid metabolism
   00061 Fatty acid biosynthesis
    PHYPADRAFT_115301
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    PHYPADRAFT_115301
Enzymes [BR:ppp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     PHYPADRAFT_115301
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     PHYPADRAFT_115301
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 2238 aa AA seqDB search
MVAQVVPEVVCANGAINSTVKKNGTSVSPVEEYCYALGGKDPIRSILIANNGMAAVKFMR
SVRSWAYESFGVERAVELVAMATPEDMRINAEHIRMADQFVEVPGGTNNNNYANVQLIVE
IAERTGVQAVWPGWGHASENPELPDSLLARGILFLGPPAAPMNALGDKIGSSLIAQAAGV
PTLPWSGSHVNVPFDVLQGSIPDDLYKQACVSTTEEALASCQVVGYPAMIKASWGGGGKG
IRKVHNDEEVKALFKQVQGEVPGSPIFIMKVATQSRHLEVQLLCDQFGNVAALHSRDCSV
QRRHQKIIEEGPITIAPPETVRRLEQGACRLAKCVNYIGAATVEYLYSMETGEFYFLELN
PRLQVEHPVTEWIAEFNLPAAQLGVAMGIPLWRMPEIRRLFGQGGGGHDSWRKVADEAVQ
FDLEKVESQKPKGHVVAVRVTSEDPDDGFKPTSGQVQELSFRSKPNVWAYFSVKSGGGIH
EFSDSQFGHVFAFGETRAMAIANMVLGLKELHIRGEIHTNVDYTVDILHAPEYRDNKIHT
GWLDSRIAMRVRAERPPWEISVVGGALYKASRLIAARVTEYIGYLEKGQIPPKNISLVNF
HISLNIDGIKYNMELTKGGPGSYLLRLNKSEVHAEAHTLRDGGLLVQLDGNSHVVYAEEE
AAGTRLLIDGRTCLLQNDHDPSRLIAETPCKLMRFLVPDGSHVNADAPYAEVEVMKMCMP
LLSPASGTIHFRLSEGSAMMGGDLIASLDLDDPSAVRKALPFEGNFPPLGFPTAVGAKVH
QRCADSLNAARNILAGYEHDLDEVVKNLLSCLDDPQLPMLQWQECMAVLATRIPKDLKAQ
LDAEFREYEISFQQGGVGPDFPAKALTGLIEAFVDNTPDKDRVTLERLVEPLLLLARSYE
GGREGHACSIVQTLFNVYLSVEEVFNENAQADVIEGLRQQHKKDLARVVDIVLSHQGVKR
KNQLILKLMGALVYPNPAAYRDQLIRFADLNHSNYSELALRASQLLEQTKLSELRSNIAR
NLSEFSMFTEDGGEGHSTPRRRSAIEERIDTLVDAPLPVEDALVSLFDHGDHTLQRRVIE
SYIRRLYQPYLVKGSVRMQWHRSGLIATWQFWEEYPPPTAEMLESIKVSIDDSQGVKRWG
AMVILTSLQVLSNAVGAALKDAESTLTPTSKAAAIGFGNVLHVALVGINNPMSAFQDSGD
EDQINERVEKLAKALKGESLGAMLQVSGVGVVSCVIQRDEGRAPTRHCFQWSHEHHYFAE
EPLLRHVEPPLSNLLELEKLKGFTNMQFAPSRNRQWYIYNAVDGKTRTRRMFLRALIRQP
KPRDESGYENLDSRSITLVEDSITQSLQGALDELELAVHDTNSKADHIHVYLCILRAQEL
GDLTQASRKESGSTTNQVERVVRVLEGLAHEVYFKLGARMHRLAIAGWEIRVRLKELQAA
NGAWRVVVSNPTGHTCTVQVYREAQDKDSGKVIYWSPFTPVPAPLHGVPLSAHYKSLDAI
AQKRLAARRQNTTYCYDFPLVFETVLRQSWVDAAEAGVKPQGCTPIFKATELVLANSSGG
WDTGLVETARPVSSNNVGMVGWRMHMSTPEFPEGRDVLVVSNDVTFSAGSFGPAEDVYFK
SMTELACREKLPLIYLAANSGARIGVAEEVRACFRIGWLEDSSPDRGFKYLYLTPEDYEL
LSTSVIAHELRLDSGEVRWVIEDVIGKQDGIGVENLSGSGAIAGAYSKAYRETFTLTYVS
GRTVGIGAYLARLGMRCIQRLDQPIILTGFSALNKLLGREVYSSHMQLGGPKVMAVNGVV
HLTVADDLEGVSAILKWLSYVPSYVGGPLPCLQSVDPPERAVEYCPETSCDPRAAIRGLD
SNGKWLGGIFDKGSFTETLEGWAQTVVTGRAKLGGIPVGIVAVETQTVTQKIPADPGQLD
SSERLVPQAGQVWFPDSAQKTAQALIDFNKEGLPLFILANWRGFSGGQRDLFEGILQAGS
MIVEHLRVYQQPVFVFIPKTGELRGGAWVVVDSKINPDKVEMYAEKTARGGVLEPEGMVE
IKFRMRELIECMHRIDPQLITLRQQLQQLKGAPIATSDRIQQQIKSREKALTPVYKQIAI
KFAELHDTPNRMAAKGVIKKVVDWGESRHFFFQRLKRRLAEESLIQQLLVAGGPNMCHSA
ALALIKDVFTTSTGGPWEWTDDAQFLAWSSQPTGLEVHLNELREKHVVKEMVALGSSAEA
LKALPQGLNALLRSVSLQ
NT seq 6717 nt NT seq  +upstreamnt  +downstreamnt
atggtggcccaagtggtgcccgaggtggtttgcgcaaatggggcgataaattccacggtg
aagaagaacgggacgagcgtatcgccggtagaggagtactgctatgcgcttggaggcaaa
gatcccatacgcagcatcttgattgcgaacaatggcatggccgctgtcaagttcatgcgg
agcgtgcgctcttgggcgtacgagagtttcggagtcgaaagggccgtggagcttgtggcc
atggcgactcccgaagacatgcgcatcaatgctgagcacattcgcatggctgaccaattc
gtggaagtcccagggggaaccaacaacaataactacgccaacgttcagttgattgtcgag
attgcggagagaacaggggtgcaagccgtgtggccaggatggggtcacgcatccgagaac
cccgagctcccagactcgctgttggcgcggggcattctcttcctgggccctccagcagcc
cccatgaacgctcttggcgacaaaattggatcctctcttattgcacaggcggctggtgtg
cccacactcccgtggagtggttctcacgtgaatgtgccatttgatgttctccaaggcagc
attccggatgatttgtacaaacaggcttgcgtttccaccacagaggaagctttggcttca
tgccaggtagtcggctaccctgccatgatcaaggcctcttggggaggtggtggtaaagga
attcggaaagtacataacgatgaagaagtgaaggctttgttcaagcaggtgcagggagaa
gtgccaggttcaccaatcttcataatgaaggtcgccacacagagccgacatctcgaggtt
caactgctttgtgaccaatttgggaatgtggcagccctgcatagccgtgactgtagtgtg
caaagacggcaccaaaagattatcgaggaaggtcctatcacgattgctcctccggaaaca
gtgagacgcttagagcaaggcgcctgtcggcttgccaagtgtgtgaactatattggagcc
gcaactgttgagtacttgtacagtatggaaactggggagttctacttcttggagctcaat
cctcgtctccaggtagagcatcctgtcacagaatggattgcagagtttaatttgccagca
gctcaattgggtgtcgccatgggcatcccactttggcgtatgcctgaaattcggcgtctc
tttggccaaggaggcggtggccacgattcttggaggaaggtggctgatgaagcagtacaa
tttgatttggaaaaagttgagtctcaaaaacccaagggtcatgtcgtagctgtgcgggtc
acgagtgaagaccctgatgacgggttcaagcccactagtggtcaagttcaggaactcagt
tttaggagtaaaccaaacgtgtgggcttacttttcagtcaagtctggaggaggcattcac
gaattttcagattcccaattcggtcatgtttttgcttttggagaaacgcgggctatggcc
attgccaacatggtgctgggactcaaggaacttcacattcgaggagagatccatactaat
gttgattacactgttgacattctgcacgcacctgaatatagagataataagatccacacg
ggctggctggatagtcggattgctatgcgagtgcgagctgagcgacctccttgggagatc
tcggttgtgggcggtgctttatataaagcaagcaggttaattgcagctcgtgtaacggag
tacattggctatttggaaaagggccaaatcccacccaagaacatctcgcttgtcaatttt
catatctctctcaatattgacgggatcaagtacaatatggagttaactaaaggagggcct
gggagctatctgctccgcttgaataaatctgaagtgcatgctgaagctcacactcttcga
gatggaggccttcttgtccagctggatgggaacagtcacgtggtctacgcagaagaagag
gcagcgggcactcgcttgcttattgatggacgcacgtgccttttgcagaatgatcatgat
ccatcgcgattgattgctgaaacaccttgcaagttgatgcgtttcttggtgccagatggc
agccatgtaaacgctgatgctccatacgcggaggtggaggttatgaagatgtgcatgcct
cttttgagcccagcatctggaaccattcatttcagattgtctgagggctcggccatgatg
ggtggagatctcatagcttcactagaccttgatgacccgtcagccgtgaggaaggccctg
ccttttgagggcaactttccgcccttgggatttccaacagccgttggcgctaaagttcat
caacgctgcgctgacagcctcaatgctgcgcggaatatcctagctggttacgagcatgat
cttgatgaggtggtgaagaacttgcttagctgtttggatgatcctcagctacccatgctg
caatggcaggagtgcatggctgttcttgcaacccgaattccaaaggatttaaaagcgcag
cttgatgctgaatttcgtgagtatgagatcagtttccagcagggtggagttggtccagac
tttccagctaaggcacttactggattaatcgaggctttcgtggacaatactcctgacaag
gaccgagtgactctagagcgcctcgtggaacctctgctgcttctagccagatcttatgag
ggtggcagagaaggacatgcttgcagcattgttcaaactctgtttaacgtgtacctttcc
gtggaggaggtttttaacgagaatgcacaggctgatgttatagaagggttgcggcagcaa
cataagaaagaccttgcgagagtggttgatattgtcctgtctcaccagggtgtgaagagg
aaaaaccagctcatcttaaaactgatgggagccttagtatacccaaatcctgctgcctac
cgtgaccaacttatccgctttgcagatcttaatcacagcaactactccgagctggccttg
cgggctagtcagctgcttgagcagacaaaactgagtgagctgcggtccaacatagcacga
aacctgtctgagttttcgatgtttacggaggatggaggtgagggtcacagcactcctcgg
cgccgcagtgccattgaggagcgtattgacaccttggtggatgcacctttgcctgttgag
gatgccctggtgtccttgtttgatcacggtgaccataccttacagcgtcgtgttattgaa
agctacattcgcagactttatcagccatatctggtgaagggctcagtgagaatgcagtgg
caccgctccgggttgattgcaacctggcaattttgggaagagtatcctcctccgaccgcc
gagatgctggaatccataaaggtttccatcgacgatagccaaggcgtcaaaaggtgggga
gctatggtgatacttacttctctccaggtgctctccaacgcagtcggggctgctctcaag
gatgccgaaagcacacttacaccaacctcaaaagcagctgcaattggttttggcaatgtt
ctacatgtggcattggtaggcatcaacaatccaatgagcgcattccaagacagtggggac
gaggaccaaatcaacgaaagagtagagaaactggcgaaggctctaaagggtgagagtttg
ggtgctatgctccaagtatctggtgtgggagtggtgagctgtgttattcaacgtgatgaa
gggcgtgcacccactcggcattgcttccaatggtctcatgaacaccattactttgctgag
gagcctcttcttcgccatgtcgaaccacctctttctaatctccttgagctcgaaaagctg
aagggtttcaccaacatgcagttcgcgccatcacgcaaccggcagtggtacatttacaat
gccgtggatggaaagaccaggactcgcagaatgttcttgagggctctaattcggcaacca
aaacctagggacgagagtggatatgaaaatcttgattcacgtagtatcactctagtggag
gatagcatcacccagtctcttcaaggagccctggacgagttggagcttgctgtccacgat
accaatagcaaggctgaccatattcatgtgtatctctgcattctccgtgctcaggagctt
ggcgacttgacgcaggcatcaaggaaagagagtggcagcactacaaaccaagtggagaga
gtggtccgtgtgttggaaggtttggcacatgaagtatatttcaaactcggtgcacgcatg
catcgccttgctattgctggttgggaaatccgtgttcgtctgaaggagcttcaggcagcc
aacggcgcatggcgtgttgtagtttctaacccaacaggccacacttgcaccgtccaggta
taccgagaggctcaagacaaggattcaggcaaggtgatttactggtcacctttcactcct
gtgcctgcgccgctgcacggcgtgcccctatctgctcattacaaatcgttagacgccatt
gctcagaagcgtcttgcagcgaggcgtcagaataccacgtactgctacgacttccccttg
gtttttgagacagtgctgcgccaatcctgggtagatgctgccgaggctggcgtaaagccg
caaggatgtaccccaatttttaaagcaaccgagctcgtgctggcgaattctagcggaggc
tgggacacgggtcttgtagaaactgctcgtcctgtgtcgagtaacaatgtgggtatggtg
ggatggcggatgcatatgtccacgccagagtttccagaggggcgggatgtattggtagtc
tcaaatgacgtgacgttcagtgctggctcgttcggacctgcggaggatgtttatttcaag
tctatgactgagttggcgtgtcgggagaagctcccgctgatctatctcgcagcgaattca
ggcgctcgcattggagtggctgaagaagttcgcgcctgctttcgtattggctggttggag
gactcgtctcctgatcgcggcttcaagtacctgtacttgacgccggaggattacgagcta
ctttcaacctctgttatcgcgcatgagctgagacttgactcaggagaggtgagatgggtc
atcgaagatgtaattggaaagcaggacgggattggagtggagaatctctcaggcagtggc
gcaattgcaggcgcatactccaaagcatatcgtgaaactttcacattgacttacgtctca
ggccgtaccgtcggaattggtgcgtaccttgctcgtctcggtatgcggtgcatccagcgt
ctcgaccagcccatcatcctgacgggcttctcagcgctcaataaactgctggggcgcgaa
gtctatagctctcacatgcagctgggcgggccgaaagtgatggcggtgaatggtgttgtc
cacctcacggttgcagacgatcttgaaggcgtttctgcaatcttgaagtggctgagctac
gtgccctcttacgtcggcggccctcttccctgcctgcaatccgtggatccacccgaaagg
gcagtggagtattgtcccgagacgtcgtgcgacccgcgtgctgcaattcgtggcctcgat
agcaatggcaaatggttgggcggtattttcgacaagggaagctttaccgagactctcgaa
ggctgggcgcagactgtggtcactggacgagccaagctgggcggcattccggttggaatc
gtggctgtagagacacagacagtcacacaaaagattccagccgatcccggccagcttgac
tcctccgagcgactggtgccccaagctggtcaagtttggttccctgactctgctcagaaa
acggcgcaagcgttgattgatttcaacaaggagggtctcccgctcttcatcctcgcgaat
tggagagggttctcaggtgggcagcgcgacctcttcgaaggcatcctgcaagccgggtcc
atgatcgtagagcacctgcgcgtgtaccagcagcccgtgttcgtgtttattcccaaaacg
ggagagcttcgtggtggtgcgtgggtggtggtggacagcaagatcaaccctgacaaggtg
gagatgtacgctgaaaagacagctcgcggaggagtcttggagcccgaaggtatggtcgag
atcaaattccgcatgcgtgagcttatagagtgcatgcaccgcatcgacccccagctcata
accttgcggcagcaactacagcagcttaaaggcgcccctatcgctacatctgataggatc
cagcagcaaatcaaatctcgagagaaagccctcacgcctgtgtacaaacaaattgctatc
aaattcgcggagcttcacgacactcccaaccggatggccgccaagggggtcatcaagaag
gtagtagattggggcgaatcccggcatttcttcttccagaggttaaagaggaggcttgct
gaggaatccttgattcagcagcttctagtagcgggtggtccgaacatgtgtcattccgca
gccttggcattgatcaaagatgtcttcaccacgtcaacaggcggaccttgggagtggaca
gatgacgcacagtttctggcgtggagcagccaaccaactgggcttgaagtgcatttgaat
gagcttcgtgagaagcacgtggtgaaggagatggtggccttgggatcctcagctgaagca
ttgaaggccctccctcaagggttgaacgcactactgcgctcggtaagcttgcaatga

DBGET integrated database retrieval system