KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_115585Help
Entry
PHYPADRAFT_115585 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PHYPADRAFT_115585
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PHYPADRAFT_115585
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PHYPADRAFT_115585
Enzymes [BR:ppp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PHYPADRAFT_115585
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 268 aa AA seqDB search
MTRIADTFSTLKQLGKVAFIPYLTAGDPDLDTTAQALRLLDDCGADIIELGVPYSDPLAD
GPVIQACAAATRSLSKGTTLDKVLSMLKEISPSLKAPVVLFTYYNPILKRGMEPFLKAVK
EAGGSGLVVPDIPLEETDKLRERSVANGLELILLTTPTTPKSRMKIIAKASQGFVYLVSL
TGVTGARTSVQSRVETLLKELKEQVTDKPVAVGFGISKPEHAVQVVEWGADGVIIGSAMV
KILGEAASPKEGLAELEKFTKDLKNSIS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgactagaattgctgacacattttctacacttaagcagctaggaaaggtggccttcatt
ccatacttaactgccggcgaccctgacttggatacaacggctcaggcattacgtctactg
gatgactgtggagcagacatcatagagcttggagttccctactcagatcctcttgctgat
ggccctgtcattcaggcatgtgctgccgcaactaggtcgctttcgaagggcacaactctc
gataaggttttgtcgatgttgaaggagatctcaccaagcttgaaagctccagttgtgctt
ttcacatactacaatcctattctgaagcggggcatggaacctttcctgaaggctgtcaaa
gaggctggaggctctggcttagttgtaccagatattcctcttgaagagacggacaaactc
cgggagcgatccgtggcaaacggccttgaattgatcttgttgacaactcctactacaccc
aaatctcgcatgaaaataattgccaaggcctcgcaaggcttcgtctatttggtaagtctt
actggagttacaggagcacgtacttcagttcagagccgtgtggaaactctcttgaaagag
ttgaaggagcaggtcaccgacaaaccagtagccgttggttttggaatttccaagcctgaa
catgctgtacaggtggtagagtggggagccgatggtgtgattataggcagtgctatggtt
aagattctaggagaggctgcaagtcctaaagagggcctggctgaacttgaaaagttcaca
aaggatttgaaaaattccatttcttga

DBGET integrated database retrieval system