KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_115585Help
Entry
PHYPADRAFT_115585 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ppp01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ppp00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ppp00400]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 268 aa AA seqDB search
MTRIADTFSTLKQLGKVAFIPYLTAGDPDLDTTAQALRLLDDCGADIIELGVPYSDPLAD
GPVIQACAAATRSLSKGTTLDKVLSMLKEISPSLKAPVVLFTYYNPILKRGMEPFLKAVK
EAGGSGLVVPDIPLEETDKLRERSVANGLELILLTTPTTPKSRMKIIAKASQGFVYLVSL
TGVTGARTSVQSRVETLLKELKEQVTDKPVAVGFGISKPEHAVQVVEWGADGVIIGSAMV
KILGEAASPKEGLAELEKFTKDLKNSIS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgactagaattgctgacacattttctacacttaagcagctaggaaaggtggccttcatt
ccatacttaactgccggcgaccctgacttggatacaacggctcaggcattacgtctactg
gatgactgtggagcagacatcatagagcttggagttccctactcagatcctcttgctgat
ggccctgtcattcaggcatgtgctgccgcaactaggtcgctttcgaagggcacaactctc
gataaggttttgtcgatgttgaaggagatctcaccaagcttgaaagctccagttgtgctt
ttcacatactacaatcctattctgaagcggggcatggaacctttcctgaaggctgtcaaa
gaggctggaggctctggcttagttgtaccagatattcctcttgaagagacggacaaactc
cgggagcgatccgtggcaaacggccttgaattgatcttgttgacaactcctactacaccc
aaatctcgcatgaaaataattgccaaggcctcgcaaggcttcgtctatttggtaagtctt
actggagttacaggagcacgtacttcagttcagagccgtgtggaaactctcttgaaagag
ttgaaggagcaggtcaccgacaaaccagtagccgttggttttggaatttccaagcctgaa
catgctgtacaggtggtagagtggggagccgatggtgtgattataggcagtgctatggtt
aagattctaggagaggctgcaagtcctaaagagggcctggctgaacttgaaaagttcaca
aaggatttgaaaaattccatttcttga

DBGET integrated database retrieval system