KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_115880Help
Entry
PHYPADRAFT_115880 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PHYPADRAFT_115880
Enzymes [BR:ppp01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     PHYPADRAFT_115880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 260 aa AA seqDB search
MCVALNMKNWVNFTLLESHRVAHNTRIFRFELDPKASLGLQPISHILVRGEVVNRRGRLE
KITRSYVPVSDLGATGYFDLLIKILPDGMLSQRIARLNPGDSLEMRGPVVELPYKANMKT
HLGMIAGDIGITHMVQLIKAIVLNPNDYTQQVSLIYENESPEDILLKEELDKLSRAYPNF
KVFYTVNIAGREWEGGVGHITAEMIYKALPHPSPNTLVLVAGPSTFMDRVCGRKDQERYS
GQVLGLLKQLGYKKEHVYKF
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgtagcattaaatatgaagaattgggtgaattttacgttgctggagagccacaga
gttgcacataacacgaggattttcaggtttgagcttgatccaaaagcgagcctgggcctt
caaccgatttctcatatcctcgtgagaggtgaggtcgttaatcgccgtggaaggctagag
aaaataacacgctcatatgtaccggtttcagacctgggtgcgacaggatattttgactta
ctgatcaagatcctccccgatggtatgttgagtcaacgaattgctcgtctgaatcctggt
gattcacttgaaatgagaggcccggtcgtagagctgccttacaaagccaacatgaaaaca
catttgggtatgattgctggtgatattggaatcacccacatggtgcagttgatcaaggcc
atcgtgttaaatcccaatgattatactcagcaggtctcgcttatctatgaaaatgaatct
ccagaagacattctgttgaaagaggaactggataaattatctcgagcgtatccaaatttt
aaggtgttttatacagtaaatattgcgggtagagaatgggagggcggtgtgggacacatc
acggcagaaatgatttacaaagcactaccacatccgtctcctaacactctcgtgctggtt
gccggaccttcaacctttatggaccgtgtttgtggaaggaaagaccaggaacggtacagt
ggccaggtgcttggactactcaagcagcttggctacaagaaggagcacgtctataaattt
tag

DBGET integrated database retrieval system