KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_118142Help
Entry
PHYPADRAFT_118142 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K01177  
beta-amylase [EC:3.2.1.2]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ppp00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 483 aa AA seqDB search
MHETATSRGVRGGVPVFVMLPLDTVSMNNTLNRRRALDASLLALKSAGVEGVMMDVWWGI
VEKDGPQQYNWSAYQELIDMVRKHGLKVQAVMSFHQCGGNVGDSCNIPLPPWVLEEVRKN
PDLAYTDKAGRRNSEYISLGADNVPALKGRTPVQCYADFMRSFRDNFDDFLGDFIVEIQC
GMGPAGELRYPSYPESEGRWRFPGIGEFQSYDKYMIASLKANAQKVGKPAWGFSGPHDAG
SYNQWPEEAGFFKKDGTWSSEYGQFFLEWYSEMLLAHGERILSQATGIFRGTGAIISGKV
AGIHWHYGTRSHAAELTAGYYNTRTRDGYSPIAQMFAKYGVTLNFTCIEMRDFEQPSHAL
CSPEGLVRQVALATRKAGISMAGENALPRFDNSAHEQIVRKSRLQMNEKGDCQEEYEPMS
AFTFLRMCESLFHSENWRLFVPFVRHMEEGRTFQPWEEESHRTQNHMHVTQPLGQEAASL
MYH
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgcacgagacggcaacaagcagaggtgttcgtggcggcgtccctgtgttcgtgatgctc
cctttggacaccgtaagcatgaataacactctgaacagacgtcgcgccttggacgcatct
ttgctggctctgaaatcggctggtgtggagggggttatgatggatgtttggtggggaatc
gtcgagaaagatggccctcagcagtacaattggtctgcgtatcaagagttaattgatatg
gtgcggaagcatggtttgaaggttcaggctgtgatgtcctttcaccagtgtggtggcaac
gttggcgacagttgcaatattcctctgcctccatgggtgttggaagaggtacgaaagaat
ccagacttggcctacaccgataaggctggaaggcgcaactcagaatacatctctcttggc
gctgacaacgtgcccgctttgaagggaaggacaccggttcaatgctatgcggatttcatg
aggagcttcagagacaacttcgacgattttttgggagattttattgtcgaaatccaatgc
ggaatgggacccgctggtgaacttcgttacccttcataccctgagagtgagggtaggtgg
cgttttccaggcattggtgagtttcagtcttacgacaaatacatgattgcgagcttgaaa
gccaatgctcagaaggttggaaagcctgcatggggttttagcggtcctcacgatgctggc
agttacaaccagtggcccgaggaagcaggattcttcaagaaagatggcacgtggtcttca
gaatatgggcagtttttcttggaatggtattcagagatgcttctggcccatggtgaacgc
attttgtcacaagctactggcattttcaggggcactggagctatcatttcaggcaaagtt
gctggtatccattggcactacggcaccagaagtcatgctgctgagttgacggcgggatac
tacaacactcggaccagggatggatattcgcccattgcccagatgttcgccaagtatggg
gttaccctgaatttcacatgcatcgagatgcgagacttcgaacaaccatcacatgcactg
tgcagcccagaaggtctggtgagacaggtggcattggcaacacgaaaggcaggaatttca
atggctggtgagaacgctcttcccaggttcgacaattcagcgcatgaacagatagttcgc
aagtcgagattgcaaatgaacgagaaaggcgattgtcaggaggagtatgagccgatgtct
gctttcaccttcttaagaatgtgtgagagcttgttccacagtgaaaactggagactgttc
gttccgtttgtgcgccacatggaggaaggacgaacgtttcagccctgggaggaagaatca
cacagaacgcagaatcatatgcatgtgactcagcccttgggccaagaagcagcctcgttg
atgtaccactga

DBGET integrated database retrieval system