KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_118942Help
Entry
PHYPADRAFT_118942 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K00430  
peroxidase [EC:1.11.1.7]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Phenylalanine metabolism
Phenylpropanoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Amino acid metabolism
   00360 Phenylalanine metabolism
    PHYPADRAFT_118942
  Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    PHYPADRAFT_118942
Enzymes [BR:ppp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.7  peroxidase
     PHYPADRAFT_118942
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 317 aa AA seqDB search
MQLVVQGSLDNQYGLRKSYYGVSCPNAEEIVTKTVTKAVKHDSRSAASLVRLFFHDCFVS
GCDGSVLLDNSTTAMSEKEARPNINTLRGFGIIERIKESLENACSETVSCADILALAARD
SVVQTGGPHYDVLLGRRDSIIANYTGANAVLPSPKFNVTTLTKKFLDVGLTSEDMVTLSG
AHTIGKTHCTSITTRLYNQSGTTKPDPAIPAEMLRKLQTKCPNDPTDLKTTLVLDDETPE
VFDNQYFKNLLNKRGILYSDQILADTEGFNLDLVNLYANDQNAFFDAFVKSMTRMGNISP
LMGTSGEIRKRCDRVNL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcaattggttgtacaaggctccttagataaccaatacggtctcagaaaatcctactac
ggggtctcgtgtcccaacgccgaggagattgttactaaaactgtgaccaaagcagtgaaa
cacgactcccgatcagctgcttcacttgtgcgcttatttttccatgactgctttgtctcg
ggttgcgatggatcggtgctgctggataattccaccacagcaatgagtgagaaagaggct
cgtcccaacatcaacacattacgcggattcggaatcattgagcgcatcaaggaatcgctt
gagaatgcttgcagtgaaaccgtctcatgtgctgacatattagctcttgctgcccgagat
tctgtcgttcagactggagggccccattacgacgtattgctgggtagacgagatagcatc
atagccaactatactggtgctaatgctgtgcttccgtcaccaaaattcaacgttacgact
ctcacgaaaaaatttcttgacgtcggcttgacctcggaggatatggtcactctatcaggt
gcccacacaattggcaagactcactgtacctcgatcacaactcgcctctataatcaaagc
ggaaccaccaagcccgatcccgccattccagcggagatgctcagaaagctgcaaaccaag
tgcccgaacgaccctaccgacctcaaaacaacactcgttctggacgacgagactcccgaa
gtcttcgacaatcagtacttcaaaaatcttctaaacaaacgaggtattctgtattcagat
caaattctggcagacacggaagggttcaacctcgacttagtgaacttgtatgccaacgac
cagaacgctttcttcgacgcattcgtaaaatcgatgacgaggatgggaaacatcagccct
ctgatgggaacgagcggcgaaatccgcaaacgatgcgacagagtgaatctgtaa

DBGET integrated database retrieval system