KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_118958Help
Entry
PHYPADRAFT_118958 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PHYPADRAFT_118958
Enzymes [BR:ppp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PHYPADRAFT_118958
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 240 aa AA seqDB search
TRHYNFETIVLEPKGEHLATIVWLHGFSDSGARCFICLRIFTVKIKWIIPTAPLARDIPV
TAWFELRYGQDVDMEGLNRSAETVANLLRNEKTEGSKNVKLAVGGFSQGCATALYITACS
VLGKYGGTGKPFPVKLDAAIGLSGWMPTTKDFVSRMAGNRDASERAGKTSIFIGHCDDDG
VVPARSAKTSSDAFRGVGFNDVTLKTYVNGGHSATNEEIADIQEWITTKLGLEKSRIPAQ
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
actaggcattacaattttgagacaattgtgttggaacctaagggagagcacctagcgaca
attgtgtggcttcatggctttagtgattctggtgccaggtgcttcatttgtctccgcatt
tttaccgtcaaaatcaaatggattataccaacagcaccacttgcacgagacattccagtc
acagcttggtttgaactcagatatggccaagatgtagatatggaaggattaaatcgatcg
gcggaaactgtagccaaccttcttcgaaatgagaagacagaaggttcaaagaacgtgaaa
ctagcagttggtggattcagtcaaggttgtgctacagcgctctacattactgcgtgctct
gttcttggcaagtatggaggcactgggaagccctttcctgtcaagttggacgctgcaatt
ggtcttagcggatggatgcctaccaccaaagattttgtatctcgaatggctggtaatcgg
gatgcatctgagcgggcggggaagacttccatttttataggccattgcgatgacgatgga
gtggtgccggcgcgttcagctaaaacatcatctgatgcttttcgaggggtcggcttcaac
gatgtcactctcaagacttatgtcaatggtggacactcagctacaaacgaagagattgct
gatattcaagaatggattactactaaattaggtttagaaaaatcacggattccagcccaa
tag

  All links  
No link information was found.   
DBGET integrated database retrieval system