KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_119147Help
Entry
PHYPADRAFT_119147 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PHYPADRAFT_119147
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PHYPADRAFT_119147
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PHYPADRAFT_119147
Enzymes [BR:ppp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PHYPADRAFT_119147
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 91 aa AA seqDB search
LDYPGVGPEHSFLKDVGRAEYFSVTDDEALEAFQRLSKLEGIIPALETSHALAFLEKLCP
TLEDGTRVVLNCSGRGDKDVNSVIGYLKGKY
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
ttggattacccaggtgttggtccagagcacagtttcctgaaggatgttggtcgagcagag
tacttcagcgtgactgatgatgaagccctggaagcattccagaggttgtccaagctggag
ggtatcattccggcactggagacatctcatgccctagctttcttggaaaaactttgccct
acacttgaagacggtacccgagtggtcctcaattgcagtggtcgtggtgacaaggatgtc
aacagcgtcattggttacttgaaaggaaagtactga

DBGET integrated database retrieval system