KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_121970Help
Entry
PHYPADRAFT_121970 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PHYPADRAFT_121970
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PHYPADRAFT_121970
Enzymes [BR:ppp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     PHYPADRAFT_121970
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 332 aa AA seqDB search
MTVGAVPPTKETSNVHQSTLNNRFPLQDVLEAQQFDRDLLTSIFEVAREMEEVERDSAGS
QLLKGFLMATLFYEPSTRTRLSFESAMKRLGGEVLTTENAREFSSAAKGETLEDSIRTVE
GYSDIIVLRHFESGAAKKAADTANIPVINAGDGPGQHPTQALLDMYTIQRETGRLDNITV
GLVGDLAHGRTVRSLAYLLAKYEGVKIYFVAPDVVRMKDDIKDHLTESGVDWEESSDLMQ
VASKCDVIYQTRIQQERFGDRIDLYNEARGKYIVDTKVMDVLPKHGVVLHPLPRLDEITV
EVDSDPRAAYFRQAKNGLYIRMALLKLLLLGY
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgacagttggggctgttcctccaacgaaagaaacgagcaatgtacaccaaagcactttg
aacaacaggttcccactacaagatgtactagaagcgcaacagtttgacagggatcttctg
acctcgatctttgaggtggcgagggaaatggaggaagtggagagggattcagctggatcc
cagctgctgaaaggattcttgatggcaactctgttttatgaaccctctactcgtacaagg
ctatcatttgaatccgctatgaagaggttgggtggagaagttttgacaaccgaaaatgct
cgtgaattttcttcagctgctaagggcgagaccttggaagacagcatcaggacagtggag
ggctattcggatatcattgtgctccggcattttgaaagtggggcagccaaaaaagcagct
gatacagcaaatatacctgttataaatgctggagatggtcctggtcagcatccaacacag
gcattgctagatatgtacaccatacaacgggagactgggcgtctggataacatcacagtg
ggcctggtgggcgatttagctcatgggcgtactgtacgatcattggcgtatcttctcgcc
aagtatgagggagttaagatatattttgttgctcctgatgtggtcagaatgaaggatgat
atcaaagatcatttaaccgagtcaggagtggattgggaagaatcctccgatttgatgcaa
gtggcatcaaagtgtgatgtaatataccagactcgcatccaacaagagaggttcggtgat
cgcatcgacctctacaatgaggctcgagggaagtacatagtggataccaaagtcatggat
gtgttgcccaagcacggagtggtcctccatccgctaccacggcttgatgaaataactgtg
gaggtggacagtgatccccgagctgcttatttccggcaagctaagaacggtctttacatt
cggatggccctcttgaagttgcttcttctcggctactaa

DBGET integrated database retrieval system