KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_121998Help
Entry
PHYPADRAFT_121998 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PHYPADRAFT_121998
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PHYPADRAFT_121998
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    PHYPADRAFT_121998
Enzymes [BR:ppp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     PHYPADRAFT_121998
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 407 aa AA seqDB search
YLMLNMDYRQRALIVLGTQFGVDRKRLKGLMQHYMTLNSVGNTEETIEDKTSDSGIDAAH
YRTERDLRAALVPLSSRLFEQMNGQVGGLKFLVDLRADLKTALLKNNLASLRALDSDLQG
LFATWLSPACLELHRITWNDAACLLEKIVTYEAVHPITNLYDLKRRLGTGRRCFGYFHPA
MPGEPLVFIEVALTKGIEGSAQKVLFGEPPCDEAVADCALFYSITSTQPGLKGIELGNFL
IKRVVHLLRQEMPEVQNFVTLSPIPGFMHWLLAKLATQCHVQKSGDKSANSKLSEKLLFP
EEEVKLEACRDEGNSKGPVEFMYDVLSSAEHEWASSEKLLEALRPPLLRLCARYILQEKK
RGAALDPVTNFHVRNGASVEQLNWMGDTSSKGLAASAGLMVNYRYRH
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
tatttgatgttgaatatggattatcgtcaaagagctttgattgtgctagggacccagttt
ggagtggatcgaaaaaggttgaaagggcttatgcagcactacatgaccttgaattctgtt
ggcaatactgaagaaacaatcgaggacaaaacaagtgatagcggtatagatgctgctcat
tatcgtactgagcgagatttacgagctgcccttgtgccattatcgtcacgattgtttgag
cagatgaatggacaagttggtggcctcaagtttctagtggatcttcgtgcggacctgaag
accgcgctgctgaagaacaacctcgcatcacttagagcactggacagtgacttgcagggc
ctctttgcaacatggcttagtccagcatgccttgagttgcatcgcatcacttggaatgac
gctgcctgcctactagagaagatagtcacttacgaggctgtacatcctatcaccaatctc
tacgatttgaagcggcgcctgggaactggaaggagatgttttggctacttccatcctgcc
atgcctggtgaaccgctggtcttcattgaagttgctttgacgaagggtattgaagggtca
gctcagaaagttctttttggagaacctccttgtgatgaagctgtggcagattgtgcactc
ttttattcaataactagtacccagccaggactaaaaggcattgagctgggaaactttctg
ataaagcgtgttgtacatctacttcggcaagaaatgcctgaagttcagaattttgtaact
cttagtcctattccaggcttcatgcattggttgcttgcaaaattggcaactcagtgccat
gttcagaaatctggggataagtctgcaaatagcaaactgagtgaaaaattgctctttcca
gaagaagaagtaaagctggaggcttgcagggatgagggaaattcgaaaggtccagtggaa
tttatgtatgatgttctgtcgtctgcggaacatgaatgggccagctcagagaagctgtta
gaagctctgcgtcctcctcttttgcgattgtgtgctcggtacatacttcaggaaaagaag
cggggagctgcattagatcctgtaactaattttcatgtccgaaatggagcaagtgtggaa
caacttaactggatgggagacacttcatccaaaggacttgccgcgagtgcaggtcttatg
gttaattaccgatacaggcattga

DBGET integrated database retrieval system