KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_122530Help
Entry
PHYPADRAFT_122530 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PHYPADRAFT_122530
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PHYPADRAFT_122530
   00630 Glyoxylate and dicarboxylate metabolism
    PHYPADRAFT_122530
Enzymes [BR:ppp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PHYPADRAFT_122530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 543 aa AA seqDB search
MSIPAGVRIRGPMRPEFEKIFTRDALEFVAELERKFRPRVKYILKCREEQQARYDAGELP
SFDPATKAIREGEWTCSSPPAAIADRRVEITGPVERKMIINALNCGAKMFMADFEDSLAP
TWDNIISGQINLRDAVNRTITYEDKARNKTYKLNSKTAALLVRPRGWHLQESHIEIDGEP
ATGALIDFGFYFFHNHASYRAKHGGYGPFFYLPKMQHSREAAVWNAVFDHAEDVCGVPRG
SIRGTVLIETLPAVFQMHEILYELREHSAGLNCGRWDYIFSFIKTVRAHPDRLLPDRVQV
GMTQHFLKSYTELLIQTCHKRGVHAMGGMAAQIPIKDNPAANEAAAALVKADKLREVLAG
HDGTWAAHPGLVPLVLEVFDQNMPKANQLHVKREDVNVTCADLLQMPKGTRTLEGLRLNT
RVGVQYLAAWMTGTGSVPLYNLMEDAATAEISRVQNWQQIKYNAVLDGGLVPGMRVTKEL
FARVLDEELVRIEKEVGPAKFANGRYQEAAKLFAKQCTAPVLDDFLTLDAYRNIVTFAPT
ARM
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatccccgcgggagtgcgcattcgcggacccatgaggccggaatttgagaagatt
ttcactcgggatgctcttgagtttgtagctgagttggagagaaagttcaggccgagggtc
aagtatatcttgaagtgcagggaggagcagcaggcgcgctatgatgctggagagcttccc
agtttcgaccccgccacgaaggcgattcgcgagggagagtggacctgcagctccccccca
gccgccatcgctgaccggcgggtggagatcactggccctgttgagcggaagatgattatc
aacgccctcaactgcggcgccaagatgttcatggcggactttgaggattctttggcccct
acgtgggacaacatcatctccgggcaaatcaacctaagagatgccgtgaacaggactatc
acgtacgaggacaaggctcgcaacaagacctacaagctgaacagtaagacggctgcgctt
ctggttcgccctcgtggctggcatttgcaggagtcgcatatcgagattgatggggagcct
gcgacaggcgctttgatcgattttggattttacttctttcacaaccacgccagctacaga
gcgaagcatggtggctacggacctttcttctatttgcccaaaatgcagcactctagggaa
gctgcagtgtggaatgcggtttttgaccatgctgaggacgtctgcggggtgcctcgcggc
agcattcgcggaacagtgctcattgagacactgccagcagtatttcagatgcacgagatc
ctgtacgagctccgcgagcactccgcagggcttaactgcggacgttgggactatatcttc
agcttcatcaagactgtccgtgctcatcccgacaggctactccctgatcgtgtgcaggtt
ggtatgactcaacacttcttgaagagctacacggagctgttgattcaaacctgccacaag
cgcggcgtacacgccatgggcggcatggctgcacaaattccaatcaaggacaatcccgcc
gcaaacgaagctgctgcggcacttgttaaggctgataagctgcgtgaagtccttgccggg
cacgacggtacctgggctgctcacccaggcctcgtccccctggtgctcgaagtattcgac
cagaacatgcccaaggctaaccagttacatgtgaagcgtgaagacgtgaatgtgacctgc
gcagatcttctgcagatgcccaaggggacgagaaccctagaggggcttcgattgaacacc
agagttggagttcagtacctggcagcatggatgacaggaacaggatctgtgcccttatac
aatctcatggaggatgctgcaaccgctgaaatcagccgcgtccagaactggcaacaaatc
aagtataatgccgtcctcgatggtggcctcgtgccaggcatgcgagtgacgaaggagctg
ttcgcccgggtgttggacgaggagctcgtgcgcatcgagaaggaggtggggcctgccaaa
ttcgccaacgggcgttaccaggaggcggccaagttgtttgccaagcaatgcacagcgcct
gtgttggatgatttcctcaccctggatgcgtaccgcaacattgtaacgttcgctcctact
gctcgcatgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system