KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_122530Help
Entry
PHYPADRAFT_122530 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:ppp01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ppp00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ppp00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 543 aa AA seqDB search
MSIPAGVRIRGPMRPEFEKIFTRDALEFVAELERKFRPRVKYILKCREEQQARYDAGELP
SFDPATKAIREGEWTCSSPPAAIADRRVEITGPVERKMIINALNCGAKMFMADFEDSLAP
TWDNIISGQINLRDAVNRTITYEDKARNKTYKLNSKTAALLVRPRGWHLQESHIEIDGEP
ATGALIDFGFYFFHNHASYRAKHGGYGPFFYLPKMQHSREAAVWNAVFDHAEDVCGVPRG
SIRGTVLIETLPAVFQMHEILYELREHSAGLNCGRWDYIFSFIKTVRAHPDRLLPDRVQV
GMTQHFLKSYTELLIQTCHKRGVHAMGGMAAQIPIKDNPAANEAAAALVKADKLREVLAG
HDGTWAAHPGLVPLVLEVFDQNMPKANQLHVKREDVNVTCADLLQMPKGTRTLEGLRLNT
RVGVQYLAAWMTGTGSVPLYNLMEDAATAEISRVQNWQQIKYNAVLDGGLVPGMRVTKEL
FARVLDEELVRIEKEVGPAKFANGRYQEAAKLFAKQCTAPVLDDFLTLDAYRNIVTFAPT
ARM
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatccccgcgggagtgcgcattcgcggacccatgaggccggaatttgagaagatt
ttcactcgggatgctcttgagtttgtagctgagttggagagaaagttcaggccgagggtc
aagtatatcttgaagtgcagggaggagcagcaggcgcgctatgatgctggagagcttccc
agtttcgaccccgccacgaaggcgattcgcgagggagagtggacctgcagctccccccca
gccgccatcgctgaccggcgggtggagatcactggccctgttgagcggaagatgattatc
aacgccctcaactgcggcgccaagatgttcatggcggactttgaggattctttggcccct
acgtgggacaacatcatctccgggcaaatcaacctaagagatgccgtgaacaggactatc
acgtacgaggacaaggctcgcaacaagacctacaagctgaacagtaagacggctgcgctt
ctggttcgccctcgtggctggcatttgcaggagtcgcatatcgagattgatggggagcct
gcgacaggcgctttgatcgattttggattttacttctttcacaaccacgccagctacaga
gcgaagcatggtggctacggacctttcttctatttgcccaaaatgcagcactctagggaa
gctgcagtgtggaatgcggtttttgaccatgctgaggacgtctgcggggtgcctcgcggc
agcattcgcggaacagtgctcattgagacactgccagcagtatttcagatgcacgagatc
ctgtacgagctccgcgagcactccgcagggcttaactgcggacgttgggactatatcttc
agcttcatcaagactgtccgtgctcatcccgacaggctactccctgatcgtgtgcaggtt
ggtatgactcaacacttcttgaagagctacacggagctgttgattcaaacctgccacaag
cgcggcgtacacgccatgggcggcatggctgcacaaattccaatcaaggacaatcccgcc
gcaaacgaagctgctgcggcacttgttaaggctgataagctgcgtgaagtccttgccggg
cacgacggtacctgggctgctcacccaggcctcgtccccctggtgctcgaagtattcgac
cagaacatgcccaaggctaaccagttacatgtgaagcgtgaagacgtgaatgtgacctgc
gcagatcttctgcagatgcccaaggggacgagaaccctagaggggcttcgattgaacacc
agagttggagttcagtacctggcagcatggatgacaggaacaggatctgtgcccttatac
aatctcatggaggatgctgcaaccgctgaaatcagccgcgtccagaactggcaacaaatc
aagtataatgccgtcctcgatggtggcctcgtgccaggcatgcgagtgacgaaggagctg
ttcgcccgggtgttggacgaggagctcgtgcgcatcgagaaggaggtggggcctgccaaa
ttcgccaacgggcgttaccaggaggcggccaagttgtttgccaagcaatgcacagcgcct
gtgttggatgatttcctcaccctggatgcgtaccgcaacattgtaacgttcgctcctact
gctcgcatgtga

DBGET integrated database retrieval system