KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_123617Help
Entry
PHYPADRAFT_123617 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ppp00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 501 aa AA seqDB search
VAVVGAGVSGLAAAHRLRSAGVAVTVFEAQNAVGGKIQSFSNDGLIWEQGPNTMVETEPE
VSSLIDELGLREKQQWPVMQNKRYVVRDGKAVQLPSNPLGLITTKLLSAQAKCQILLEPF
LWKRKEVPLKEAANGRENVGNFITRHFGREVVDYLVDPFIAGTSGSDPDSVSIRHTFPDL
FAIEERYGSLLIGGVKSSFKKKSGSKKESFKVQSDSAKVTPAQKRPRGSFSFVGGMQTLA
HALSERLDEESLELNSSVLNLASDQQGNPSRNNWTVTYKKENSQQKEKHFDAVILTTPLH
NLQELGIEKNGIPYALDFIPEIVYQPMSVIVTAFKESDVKNSLKGFGVLVPRMEKKNGFF
TLGTMFSSSMFPDRAPPGQVVFTTFVGGSRNRALASAPFEEVKAVALEDLRKIVGVQGPP
VAVKHIFWKQAFPQYSLDYNEFLSSLEKMESDLPGLFYAGNHRGGLSVGKSVASGCKAAE
HVLSMLEGTGGRKIFTMASTK
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
gtggctgttgtgggagctggcgtaagtggtctagcagcagcgcatcgcttaagatctgca
ggggttgcagtcactgtttttgaggctcaaaatgcagtcggtgggaaaatacagagcttc
tcaaacgatggtctcatctgggagcagggacccaacactatggttgagactgaacctgaa
gtctcttctttgattgatgaacttggattgagggagaagcagcaatggcccgtgatgcag
aacaagcgttatgttgtcagggacgggaaggcagtacagttgccttctaatcctttgggt
cttattactactaagcttctttctgctcaagccaagtgtcaaattttgttagagccattt
ctttggaagcgtaaagaagttccattaaaagaagcagccaatggaagagagaatgttggg
aattttataacgagacatttcggtcgtgaggtggtggattaccttgtggatccttttata
gcagggaccagtggctcagatcctgattctgtctctatccgccatacatttccagatctt
tttgcaatagaagagaggtatggatcgctcttaatcggtggagtgaagtcaagtttcaag
aagaaaagtggatcaaagaaggaaagtttcaaagtgcaaagtgactctgcgaaggtcact
ccagctcagaagcggcctcgaggttcattttcattcgttggtggtatgcagacactcgct
catgcacttagcgaaagacttgatgaggaaagcctggaattgaactcatctgtcttaaat
cttgcaagcgatcagcaaggaaacccctcaaggaacaactggacggtgacatataagaaa
gagaattcgcagcagaaggagaagcacttcgatgcagtgattctgactaccccgttgcat
aacttgcaagaattaggaatcgagaagaacgggataccatacgctcttgacttcattcca
gagatcgtgtatcagcccatgtcagtgattgtgactgccttcaaggaatctgatgtcaag
aattcactgaaaggatttggtgtacttgttcctcgaatggagaaaaagaatggatttttc
actcttggtacaatgttttcatcatctatgttcccagatcgtgccccacctggtcaagtg
gttttcactacttttgttggaggaagtcgaaacagagccctagcatctgctccgtttgag
gaggtgaaagctgtggctttggaagatctgcggaagattgtcggagttcaaggtcctccc
gtggctgtaaagcatattttttggaagcaagcttttccacaatacagtctggattacaat
gaatttctgagttccctggagaaaatggagagtgaccttcctgggcttttctacgctggt
aatcacagagggggtttgtctgtcggcaaatcagttgcaagcgggtgcaaggctgctgaa
cacgtcttgtctatgcttgaaggcacgggtggtcggaagatcttcaccatggccagcact
aagtaa

DBGET integrated database retrieval system