KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_124325Help
Entry
PHYPADRAFT_124325 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PHYPADRAFT_124325
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PHYPADRAFT_124325
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PHYPADRAFT_124325
Enzymes [BR:ppp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PHYPADRAFT_124325
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 514 aa AA seqDB search
MVAASALPSSQGVAETAALGAPAVSLEKVVADSSELVASDGSGSVLKNGIEGIRDMARRQ
RTGSSPTTFSAKFVPFSPGQETDEEYSLDEVIYRSKTGMLLDVQHDMEALKRAGDGNYWK
NLFDSRVGKTTWPYGSGVWSKKEWVLPEIDDDDIVSLFEGNSNLFWAERFGKEQVLDMTD
LWVKHCGISHTGSFKDLGMTVLVSQVNRLRRLGKPLLGVGCASTGDTSAALSAYCAATGI
PALVFLPANKISIAQLVQPIANGALVLSMDTDFDGCMRLIRQVTSELPIYLANSLNSLRL
EGQKTAAIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFYMCKELGLVDRMPRLVCAQAA
NANPLYRAFKNGWETFQPIKALPTFASAIQIGDPVSIDRAIYALSQADGIVEEATEQEIM
DACAQADKSGMFTCPHTGVALVALQKLRQRGVIGRNDRTVVVSTAHGLKFTQSKVEYHSS
GLPAITSQFANPPISVADDLDSIMDVLRQKLSLK
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggttgcagcgagcgcgttgccatcgtcgcagggggtagctgagaccgccgcccttggg
gcacctgcagtgtctctggagaaggttgttgccgattcctctgaattggtagcgagtgat
ggatctgggtctgtgctgaagaatgggatagagggtatcagggacatggcgcgtcggcag
cggaccggtagctctccaaccacattctctgccaagtttgtgccgttttcgcctggacag
gagactgacgaggaatactccttggatgaggtgatttacaggagtaagactgggatgctg
ttggatgtccagcatgacatggaggctttgaagagagctggagatgggaattactggaag
aatttgttcgattcgagggtggggaaaacgacatggccttacggctctggagtgtggagc
aaaaaagagtgggtattgccagagattgatgacgatgacatcgtgagtttgtttgaaggc
aattccaacttgttctgggctgagcggtttggcaaagagcaggtcctggacatgactgat
ttatgggtgaagcactgcggtatcagtcacacaggctcgttcaaggaccttggaatgacc
gtgttggtttctcaagtaaacaggttgaggaggttgggcaagcctcttctgggggtggga
tgcgcttcaacaggggatacatcggcagctctctcagcttactgtgcagccaccggaatt
cctgcactcgtcttccttcccgcgaacaaaatttccatagctcaactggtgcagccaatc
gccaacggggccttggttctaagcatggacacagatttcgatgggtgcatgcggctcatc
aggcaggtgacttcagagctccccatctacctcgcaaactcactcaacagtctccgcctg
gagggtcagaaaacggctgcgattgagattctgcagcaattcgattgggaggttccagat
tgggtaattgtacccggaggaaaccttggaaacatctacgcattctacaaaggtttctac
atgtgcaaggagttgggtttggtggacagaatgcctagactcgtctgtgctcaggcggcg
aatgccaaccctctctacagggcattcaaaaacggctgggagactttccaaccgatcaaa
gctctccccactttcgcatcagcgattcaaatcggagatccagtttccattgacagagcc
atctacgctttgtcccaggccgatggcattgtggaggaggccacggagcaagagatcatg
gatgcatgtgctcaagcagacaagtctggaatgttcacttgccctcacacaggcgttgct
ctggttgctttgcagaaactgaggcagcgtggcgtcatcggtcgcaacgacaggacagtc
gtcgtaagcaccgctcacggactcaaattcacccaatctaaagtcgagtatcattcttct
gggctgccagcaatcacaagccagtttgctaatcctcccatctcggtggctgacgatctg
gactccattatggacgtccttcgccaaaagctctccctcaaatga

DBGET integrated database retrieval system