KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_124727Help
Entry
PHYPADRAFT_124727 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PHYPADRAFT_124727
Enzymes [BR:ppp01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     PHYPADRAFT_124727
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 358 aa AA seqDB search
MGWDFWTQSSSKGDARPVFPFTAIVGQEEMKMCLILNVIDPKIGGVMIMGDRGTGKSTTV
RALVDLLPEIQVVAGDPFNSSPEDPELMSEEVRKRVQANESLPVTTSRINMVDLPLGATE
DRVCGTIDIEKALTEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGWNTV
EREGISISHPARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVKDAELRVKIVEERGMFD
ANPKSFRVNYDITQKELRDRIDNARAILSGVKVPHDLRVKISQVCSELDVDGLRGDIVSN
RAAKAFAAFQGRTEVTAEDIRAVMPNCLRHRLRKDPLESIDSGTLVVDKFNEVFGFAS
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgggatgggatttttggacacagagttcctctaaaggtgacgctcgtcccgtgttcccc
ttcactgccattgtcgggcaagaagagatgaagatgtgcctgattttgaatgttatcgac
cctaagattggaggtgtcatgatcatgggggatcgtggaactggtaagtcgaccactgtt
cgtgctcttgtagacttgctgcccgaaattcaggtcgttgctggagaccctttcaactct
tccccagaagaccccgagttgatgagcgaggaggtcaggaagagggtgcaggcgaacgag
agcctgccagtcactacttcacgaattaacatggtggatttgccccttggagccaccgag
gatcgtgtctgcgggacaatcgacattgagaaggctctcacagagggtgtgaaggccttc
gagccgggtctattggcgaaggctaaccgtggaattttgtacgtcgacgaggttaacctg
cttgacgaccatttggtagatgtattgttggattctgcagcatctggatggaacactgtt
gagagagagggtatttcaatctcgcaccctgcccgattcatcctaattgggtctggtaac
ccggaagagggagagctccgacctcagctgttggatagattcggcatgcacgcccaggtt
ggaacagtgaaggatgccgagctgcgtgttaagattgtggaagagcgagggatgtttgat
gcgaaccccaagtctttccgtgtaaattatgacataacccagaaggagctccgcgaccga
attgacaatgctcgcgctattttgtctggcgtgaaggtgccacatgatttgagagtaaag
atttcgcaagtctgctcagagctcgatgttgacggactgaggggtgacattgttagcaac
agggctgccaaggccttcgctgccttccaaggaagaactgaagtgactgctgaagacatc
agggctgtcatgcccaactgcctgaggcatcggttgaggaaggaccctcttgaatctatt
gactccggaacgttggtcgtagacaagtttaacgaggtctttggattcgcttcttag

DBGET integrated database retrieval system