KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_125522Help
Entry
PHYPADRAFT_125522 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PHYPADRAFT_125522
Enzymes [BR:ppp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     PHYPADRAFT_125522
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     PHYPADRAFT_125522
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 465 aa AA seqDB search
TTEEEVVIAIGSNIGDRIANFNRALELMRASGIQAIRHASLYESAPAYVTDQPLFLNSAV
SAITSLDPHSLLRTLKDIESELGRTSGGIRYGPRPLDLDIIFYGNRSVTTETLEIPHARF
LERPFVLAPLADLLNDAGTRSTSHWSNHKRCDGGVAQAWNKMGGEACIGNEDLRRVIPVG
NELLDLSAKTHVMGILNVTPDSFSDGGRFMAVEDAVAHARSMAAEGADFIDIGAQSTRPG
ATRLSTEEELSRLVPVLEALTADSALKGVKLSVDTFDARVGREAVKMGVHVVNDVSGGSL
DSEMLSTVAELGVPYIMMHMRGDPTNMQSKANTTYSDVCEEVGKELNSRVVQAEAVGVPA
WRIITDPGIGFSKTLPQNLDLLKHLPVVRRVLSESSCTVSRGPMLVGPSRKGFLGKITER
QKGEDRDAATVAAAVVAAIGGANIIRAHNVRAVRDAMKVVDAIYK
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
accacggaagaagaagttgtgattgcaatcggcagcaatattggggatagaattgcgaac
tttaaccgtgccttggagctgatgcgtgcctctggcatccaagccattagacatgcttcc
ttgtatgaaagtgccccggcttatgtcaccgaccagccgctctttctaaattcagcagtg
tcagccatcacaagtcttgatcctcattcacttttgaggacgttgaaggacattgagagc
gagcttggccgcacgtctgggggtataaggtatggccccagacctctagatttggatatc
attttttacgggaaccgctctgtgaccactgagacattggaaattcctcatgccagattt
ctcgaacgtccttttgtcttagcaccattggcagatcttctcaatgatgcagggacaagg
tcaacatctcactggtctaatcataaacgctgtgatggaggggttgcacaagcctggaat
aagatgggaggggaggcctgcattggaaacgaggacctgcgaagagtgataccagtgggt
aatgagctgctggacttgtcagctaagacacatgtcatgggcatattgaacgttactcca
gatagcttcagtgatggcggacggttcatggctgtggaggatgctgtggcacatgctcgt
tcgatggctgctgagggggcagattttattgacattggggctcaatcgactcgtccggga
gctacaagactttctaccgaggaagagctttctcgtctcgtgccagtcctggaggccttg
actgccgattctgccttgaaaggtgtaaaactgtcggtagacacatttgatgcaagggtt
ggccgtgaggctgtaaagatgggagtacatgttgtcaacgatgtatcaggcggttcccta
gactccgagatgctgtcgacagtggcggagctcggggtcccttacatcatgatgcatatg
cgaggggatcccaccaatatgcagagcaaggcgaacacaacctacagcgacgtgtgtgag
gaagtcgggaaggaactaaattctcgagttgttcaggctgaagcagtcggcgtccctgca
tggcgtattatcacagatcccggtatcgggttttccaagactttaccgcaaaacttggat
ctattgaaacatcttcccgttgtgaggagagtgctttcagagagtagttgtactgttagt
cggggtcccatgcttgttggaccttctagaaaaggattcctagggaagataacggaacgt
caaaagggtgaggatagagatgctgcaacggttgctgctgcagttgtagctgccataggt
ggtgctaatattataagagcacataatgtgcgggctgttcgagatgctatgaaagtggta
gatgcaatttacaaataa

DBGET integrated database retrieval system