KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_125705Help
Entry
PHYPADRAFT_125705 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:ppp04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 352 aa AA seqDB search
MAIVVKVLALVLLLRSAVSLAAVQLDDLEESPDLGKVVELTDASIEAALNRHEYILIDFY
APWCKHCQSLSPQLDQAAPFLADGEPSIVVAKLNADKYRTMAEKYDISFYPTLKFFANGY
PTDYDGPHSANALVSHVRRLTAPAIEVYTSESRFRDFLKTHGSELPIFVGFGLEASALEK
LAHKHRNKGWFIVLGEYSEKAHEDFKFDERHALVVLRGEDEVQDVYYGPFEGPDLVNFVK
RNLPPLVTPLNIDSLKFLTEDGRPIVVGVLENNSTAEADAFIKSMKAAAQANRDFVFASI
VASQWPKFLRPFALGRKPVLPAVIIWDSKQYAKVSHLQLLISMSKSETFNQH
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcgttgtcaaggtactggcgctcgttttgctgctacggagcgccgtctcgctc
gctgcggtgcagctcgacgatttagaggaatctcctgacttgggcaaagttgtggagctc
acggacgcgtcaattgaggccgctcttaacagacacgagtacattttgatcgacttctat
gctccatggtgcaagcattgccaaagcctgtctcctcagttggatcaagcagctcccttt
ctggcagatggtgagccgtcgatcgtggtggccaagcttaacgctgacaaataccggacc
atggctgaaaaatacgatataagtttctacccgacgctgaagtttttcgccaacggatat
cctacagattacgacggtccccacagtgccaatgccttggtctcacatgtcaggcgttta
acagctcctgccatcgaggtgtacacatccgagtctcgcttccgagacttcctgaaaaca
catggatccgagttgcctatctttgtagggttcggcttagaagcatccgcattggagaag
ctggcccacaagcatagaaataaggggtggtttattgtgttgggagagtactctgagaag
gctcatgaggacttcaagtttgacgaaaggcatgcactggtggtgttacgtggagaagat
gaagtgcaagatgtgtactatggaccttttgaaggcccggatctggtcaactttgtaaag
cggaatttgccgccattggtgacacccttaaacatcgatagcttgaagttcctgacggaa
gatggtcggccgatcgtcgtaggtgtcctggaaaataattccacagccgaggctgatgcg
ttcatcaagagtatgaaggcagctgcacaggccaacagggatttcgtctttgcaagtata
gttgcctcgcaatggccgaaattcttgcgtccatttgctctaggcaggaagcctgtgctg
cccgccgtgatcatctgggacagtaaacagtacgccaaagtaagtcatcttcaactccta
atttcaatgtcaaagtctgaaacttttaatcagcactag

DBGET integrated database retrieval system