KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_126277Help
Entry
PHYPADRAFT_126277 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ppp  Physcomitrella patens subsp. patens
Brite
Enzymes [BR:ppp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     PHYPADRAFT_126277
Protein kinases [BR:ppp01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   PHYPADRAFT_126277
Exosome [BR:ppp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PHYPADRAFT_126277
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 380 aa AA seqDB search
MDVAGAGGGGAADGNIQGVPTHNGEYTQYNIFGNLFEVSRKYVPPIRPIGRGAYGIVCSA
VNSETGEEVAIKKIGNAFDNRIDAKRTLREIKLLRHMDHENIVAIRDIIRPPTRENFNDV
YIVYELMDTDLHQIIRSNQPLTEDHCQYFLYQLLRGLKYIHSAKVLHRDLKPSNLLLNAN
CDLKICDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDVWSVGCIFMELLNR
EPLFPGRDYVQQLRLITELIGSPEDHDLGFLRSDNARRYIRQLPRFARQPLDRKFPNMGP
AAIDLVEHMLRFDPARRITVEEALAHPYLATLHDINDEPICHSPFEFDFEQPSFTEEHIK
ELIMMEAIAFNPGNVGDMMS
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggacgttgcaggcgcaggtgggggaggggccgcggacgggaacatacaaggagtgccc
acgcacaacggcgagtacacgcagtacaacatcttcggcaacttgtttgaggtgtctagg
aagtatgtgccgcccattcgccccatcggccgaggcgcctacggcattgtgtgttccgct
gtgaattctgaaacgggagaggaggtggccatcaagaagatcggtaacgcgttcgacaac
aggattgatgcaaagcgcactctgcgagaaattaagctactgcggcacatggatcacgag
aacattgtggcgattcgcgacatcattagacctcccacccgggaaaacttcaacgacgtg
tacattgtatatgagctgatggacacggatcttcaccagatcattcgtagcaatcagccg
ctgacagaggaccactgccagtactttttgtaccagctacttcgtgggctcaagtacatt
cactcggcgaaagttcttcaccgtgatttaaagccgagcaatttgcttctgaatgcaaat
tgtgacctcaaaatttgtgacttcggtttagctcgaacaacctcagagactgatttcatg
acggagtacgttgtgactcgctggtacagggccccagagcttttactaaactgctccgag
tacaccgcagccattgacgtgtggtcggtaggctgcatattcatggaacttttgaacaga
gagcccttattcccggggagggattacgtccaacagttgcgcctcatcacagagctaatt
gggtcccctgaggaccacgacctggggttcttgaggagcgataacgcgagacgttacata
agacagttgcctcgattcgccagacagcccttagataggaagtttcccaatatggggcct
gctgcgattgatctagtggagcacatgctacggttcgaccctgcgcgtcgtatcacagtg
gaggaggctttggcgcacccatacctcgcgacgctgcacgatataaacgatgaaccgatc
tgccatagtcctttcgagttcgattttgagcagccatcgttcacagaggagcacatcaag
gagcttatcatgatggaagcgatagccttcaaccctgggaatgtgggtgacatgatgtcc
tag

DBGET integrated database retrieval system