KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_126277Help
Entry
PHYPADRAFT_126277 CDS       T01041                                 

Definition
(RefSeq) hypothetical protein
  KO
K20600  
mitogen-activated protein kinase 4 [EC:2.7.11.24]
Organism
ppp  Physcomitrella patens subsp. patens
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 380 aa AA seqDB search
MDVAGAGGGGAADGNIQGVPTHNGEYTQYNIFGNLFEVSRKYVPPIRPIGRGAYGIVCSA
VNSETGEEVAIKKIGNAFDNRIDAKRTLREIKLLRHMDHENIVAIRDIIRPPTRENFNDV
YIVYELMDTDLHQIIRSNQPLTEDHCQYFLYQLLRGLKYIHSAKVLHRDLKPSNLLLNAN
CDLKICDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDVWSVGCIFMELLNR
EPLFPGRDYVQQLRLITELIGSPEDHDLGFLRSDNARRYIRQLPRFARQPLDRKFPNMGP
AAIDLVEHMLRFDPARRITVEEALAHPYLATLHDINDEPICHSPFEFDFEQPSFTEEHIK
ELIMMEAIAFNPGNVGDMMS
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggacgttgcaggcgcaggtgggggaggggccgcggacgggaacatacaaggagtgccc
acgcacaacggcgagtacacgcagtacaacatcttcggcaacttgtttgaggtgtctagg
aagtatgtgccgcccattcgccccatcggccgaggcgcctacggcattgtgtgttccgct
gtgaattctgaaacgggagaggaggtggccatcaagaagatcggtaacgcgttcgacaac
aggattgatgcaaagcgcactctgcgagaaattaagctactgcggcacatggatcacgag
aacattgtggcgattcgcgacatcattagacctcccacccgggaaaacttcaacgacgtg
tacattgtatatgagctgatggacacggatcttcaccagatcattcgtagcaatcagccg
ctgacagaggaccactgccagtactttttgtaccagctacttcgtgggctcaagtacatt
cactcggcgaaagttcttcaccgtgatttaaagccgagcaatttgcttctgaatgcaaat
tgtgacctcaaaatttgtgacttcggtttagctcgaacaacctcagagactgatttcatg
acggagtacgttgtgactcgctggtacagggccccagagcttttactaaactgctccgag
tacaccgcagccattgacgtgtggtcggtaggctgcatattcatggaacttttgaacaga
gagcccttattcccggggagggattacgtccaacagttgcgcctcatcacagagctaatt
gggtcccctgaggaccacgacctggggttcttgaggagcgataacgcgagacgttacata
agacagttgcctcgattcgccagacagcccttagataggaagtttcccaatatggggcct
gctgcgattgatctagtggagcacatgctacggttcgaccctgcgcgtcgtatcacagtg
gaggaggctttggcgcacccatacctcgcgacgctgcacgatataaacgatgaaccgatc
tgccatagtcctttcgagttcgattttgagcagccatcgttcacagaggagcacatcaag
gagcttatcatgatggaagcgatagccttcaaccctgggaatgtgggtgacatgatgtcc
tag

DBGET integrated database retrieval system